Ople013979.1
Basic Information
- Insect
- Ochropleura plecta
- Gene Symbol
- Ssb-c31a_1
- Assembly
- GCA_905475445.1
- Location
- FR997728.1:7601423-7602345[-]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.1e-27 1.4e-22 80.2 0.9 1 51 43 93 43 94 0.94
Sequence Information
- Coding Sequence
- ATGCCTAAACACAAGAAGCCTGCAAGCTCCAGCAGTTCTGATAGTGACGATGGACCAGTCGACAGAAACCCTCCTGCCGAGAAAAAAGCCAAAACGGGCAGCAGGACAGAAGATAAAGAGCCAACTTGGGTTATACAAGGAAAGAAGTTGCTTAAAATCAGGGAGTTCAAGGGAAAGGTATATGTAGATTTAAGAGAATTCTATGAAAAGAATGGTGAATTGTTACCAGGCAAGAAAGGCATTAGCATGACCCCTGAACAATGGAGGAAATTGATGTCATTGAGCGATGAAGTAAATGAAACGCTTAGTACCTTAGGCTAG
- Protein Sequence
- MPKHKKPASSSSSDSDDGPVDRNPPAEKKAKTGSRTEDKEPTWVIQGKKLLKIREFKGKVYVDLREFYEKNGELLPGKKGISMTPEQWRKLMSLSDEVNETLSTLG*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01076532;
- 90% Identity
- iTF_00445217; iTF_01084301; iTF_01062836; iTF_01094952; iTF_00172994; iTF_01439970; iTF_00071460; iTF_00745732; iTF_00121477; iTF_00907080; iTF_01526056; iTF_00906188; iTF_00924717; iTF_00622862; iTF_01093134; iTF_00124307; iTF_00036757; iTF_00449141; iTF_00038808; iTF_01094073; iTF_00758202; iTF_00037851; iTF_00726395; iTF_00831259; iTF_00122432; iTF_00928739; iTF_01247018; iTF_01338794; iTF_01340147; iTF_01441130; iTF_01342251; iTF_00425423; iTF_00147492; iTF_00907920; iTF_01534866; iTF_00446177; iTF_00685475; iTF_01061925; iTF_00039848; iTF_01285576; iTF_00447177; iTF_00042669; iTF_00786030; iTF_00043536; iTF_01533968; iTF_01532049; iTF_00040851; iTF_00041811; iTF_01063796; iTF_00785238; iTF_00301210; iTF_00711898; iTF_01064698; iTF_01533083; iTF_00302144; iTF_00123412; iTF_00375256; iTF_00771961; iTF_00973819; iTF_00851836; iTF_00300249; iTF_00364062; iTF_00374152; iTF_00120544; iTF_00237613; iTF_00667520; iTF_01527264;
- 80% Identity
- iTF_01084301;