Oleu025425.1
Basic Information
- Insect
- Ochropleura leucogaster
- Gene Symbol
- -
- Assembly
- GCA_958449745.1
- Location
- OY288228.1:5045522-5045899[+]
Transcription Factor Domain
- TF Family
- PAX
- Domain
- PAX domain
- PFAM
- PF00292
- TF Group
- Helix-turn-helix
- Description
- The paired domain, a ~126 amino acid DNA-binding domain, is found in eukaryotic transcription regulatory proteins involved in embryogenesis. Initially identified in Drosophila’s paired (prd) protein, it typically resides in the N-terminal region and may be followed by an octapeptide, a homeodomain, or a Pro-Ser-Thr-rich C terminus. Paired domain proteins act as transcription repressors or activators, with DNA-binding specificity mediated by three subdomains. Crystal structures reveal a bipartite DNA-binding paired domain: an N-terminal subdomain (PAI) and a C-terminal subdomain (RED), linked by a flexible linker. Both subdomains contain a helix-turn-helix motif that binds DNA's major groove, while the linker may bind the minor groove. Variations in domain usage across Pax proteins and isoforms determine sequence specificity.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.7e-10 6.3e-07 30.1 0.1 24 70 9 55 4 78 0.89
Sequence Information
- Coding Sequence
- ATGGATACTACACCTACAGAAGCAGCACAAATCGTCGCCCTATTGCAAGAAGGGCTCAGCCAGCGGGCTGTCGCACGTCAGCTCCACATAAGCCAGTCCTGTGTTTCGAAAGTTTATAAACGGTTTCGGGAGACTGGTGGCTTTATCCCGAGACCAAGATCTGGACGGCGCCGGTGCACATCGgagagagatgaccgtttcatCGTGTCAACCTCTCTCAGAAATCGACATTTGACTGGTGTCGACGTCCAACAGGAGCTCCGAAATGTTCGTGGGGTAGCTGCCAGTGAGTGGACAGTTCGTCGAAGACTTAAGCAAGCTAATTTGACTCCAAAAAGGCCTGCCACAGGCCCGAAACTGACGACAGGTCACCGATAA
- Protein Sequence
- MDTTPTEAAQIVALLQEGLSQRAVARQLHISQSCVSKVYKRFRETGGFIPRPRSGRRRCTSERDDRFIVSTSLRNRHLTGVDVQQELRNVRGVAASEWTVRRRLKQANLTPKRPATGPKLTTGHR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00683297; iTF_00683298; iTF_00683299; iTF_00683310; iTF_00075506; iTF_01115670; iTF_00683293; iTF_00683295; iTF_01152996; iTF_00075494; iTF_01021183; iTF_01021185; iTF_01021182; iTF_01332678; iTF_00682384; iTF_01495015; iTF_01494280; iTF_00026824; iTF_00924650; iTF_01527149; iTF_00124239; iTF_00300175; iTF_00300176; iTF_01333778; iTF_00172915; iTF_00682389; iTF_01063735; iTF_00172921; iTF_00075484; iTF_01020252; iTF_00075485; iTF_00924637; iTF_00924635; iTF_00924636; iTF_01334814; iTF_01331488;
- 90% Identity
- iTF_00300177;
- 80% Identity
- -