Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 3.2e-12 8e-09 36.5 11.9 2 68 54 123 53 125 0.86

2 3 0.00021 0.52 11.5 2.2 2 22 147 167 146 173 0.88

3 3 0.0004 0.98 10.6 1.4 55 69 174 188 168 189 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	3.2e-12	8e-09	36.5	11.9	2	68	54	123	53	125	0.86
2	3	0.00021	0.52	11.5	2.2	2	22	147	167	146	173	0.88
3	3	0.0004	0.98	10.6	1.4	55	69	174	188	168	189	0.84

Coding Sequence: atgacaaCAACTAACGAACAAAAACCAGGCAATGTTGAGGTGGTGATAGACAAAAAGGCTCAAAAGGCCAGCGAGAAAATGCTACGAGCCCAAAAGAAACAAGAAATTTATCACAACTTTGCCACGCCCCTAGTGGGCACTTATTTGAATCTGAGCGAAGAGCCGGCTTTAATACGCTGCCCTAGTTGTGGCATTGAAGAATTAAGCGAAGTGGTGGATGAATTGAAATGGTGGGCTGTAGAGATTAATCGCTTTTTGGGTTGTTTATTTGTAACAttgtgctgttgctgctgcttagATTACTCTCTGCCCTGTAAGTCCAGTGATCGTAATCATTATTGTAAAAACTGTGGCTGCTACTTTGGTCGTGCTATGCGCATTCCCCCTTTAAAGAATATTGAAAATCAACAACCACCTGTGTATTTTGCTGTTGGCTCACAACCCCATGAGGTTTCGTGTCcattttgtaaacaatattCAAAGACAATTATGAAACGTTCTATACTACGCTGCTGCTTAAGGCGCCACTATTGCTCCCAGTGTGGCGAGTATTTGGGTTCATTCAGACGGCCGCAgttgtaa
Protein Sequence: MTTTNEQKPGNVEVVIDKKAQKASEKMLRAQKKQEIYHNFATPLVGTYLNLSEEPALIRCPSCGIEELSEVVDELKWWAVEINRFLGCLFVTLCCCCCLDYSLPCKSSDRNHYCKNCGCYFGRAMRIPPLKNIENQQPPVYFAVGSQPHEVSCPFCKQYSKTIMKRSILRCCLRRHYCSQCGEYLGSFRRPQL

Sequence clustering based on sequence similarity using MMseqs2