Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.015 1.5e+02 4.2 0.1 19 45 57 83 46 90 0.83

2 6 0.0083 79 5.1 0.3 22 52 88 118 83 119 0.89

3 6 0.013 1.2e+02 4.5 0.1 23 43 117 137 112 141 0.89

4 6 0.00016 1.5 10.6 0.0 19 52 141 174 135 176 0.82

5 6 0.17 1.7e+03 0.9 0.0 23 43 173 193 170 198 0.84

6 6 0.00071 6.8 8.5 0.1 21 43 199 221 194 226 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.015	1.5e+02	4.2	0.1	19	45	57	83	46	90	0.83
2	6	0.0083	79	5.1	0.3	22	52	88	118	83	119	0.89
3	6	0.013	1.2e+02	4.5	0.1	23	43	117	137	112	141	0.89
4	6	0.00016	1.5	10.6	0.0	19	52	141	174	135	176	0.82
5	6	0.17	1.7e+03	0.9	0.0	23	43	173	193	170	198	0.84
6	6	0.00071	6.8	8.5	0.1	21	43	199	221	194	226	0.90

Coding Sequence: ATGCCACCGACGTCAGCGATCAATGTCAGCATAGGTTCCTCCTACGCTGACATTGATCGCCTAATGTTCGTTGACCCCCGCATTGTTGCAGACTCGTGGGTCGCGCCCCGGCCCGGCTTCGTCACCCCGCGGCTCCGCGTTAAACGAGCAAAAAGGAAGGATATAGATAGCGCGACCAAGAAGCCGACCGAGTGCCACGTATGCCACAAGCAGTTCAAGAAAGCCTTCAGGTTAAAGGAGCACATGCGAACACACACGGGGGATAAGCCGTATCGCTGTGAAACATGCAACAAATGCTTCTCGCAATCCAGCACTTTGACGAAACACGAGCGAATACACACGGGAGCCAAGCCGTATACTTGCGAAATATGCAATAAAGACTTTTCTTTATCCGAGTCTCTAACGAGGCATCGACGAACTCACACAGGGGAAAAGCCTTACGCCTGCGAAATATGTCATGAGAAGTTCACAAATTCGGGTAACTTAAaggagcataaactaattcacaCGGTAGGAAAACCATTTTCTTGCGGAATTTGTAAAAAAGATTTCGCACGTGCGGGCAATCTGAAGGTGCATGAACGAATTCACACGGGAGAAAAGCCATACTCCTGTGCAATATGTAAAAGGAAATTTGCACAAATGAGCAATTTGAAGaaacataaactaattcatAAGGGAGAAACAAGTGCTCTTTGA
Protein Sequence: MPPTSAINVSIGSSYADIDRLMFVDPRIVADSWVAPRPGFVTPRLRVKRAKRKDIDSATKKPTECHVCHKQFKKAFRLKEHMRTHTGDKPYRCETCNKCFSQSSTLTKHERIHTGAKPYTCEICNKDFSLSESLTRHRRTHTGEKPYACEICHEKFTNSGNLKEHKLIHTVGKPFSCGICKKDFARAGNLKVHERIHTGEKPYSCAICKRKFAQMSNLKKHKLIHKGETSAL*

Sequence clustering based on sequence similarity using MMseqs2