Nudd005816.1
Basic Information
- Insect
- Notocelia uddmanniana
- Gene Symbol
- Ssb-c31a_1
- Assembly
- GCA_905163555.1
- Location
- LR991053.1:8488394-8489470[-]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 8.2e-29 4.7e-24 85.3 1.0 1 51 45 95 45 96 0.96
Sequence Information
- Coding Sequence
- ATGCCTAAACataagaagaaagaagaaagttCTAGCGACAGTGATGAGGGGCCTGTTGATAGAAATGTACCACCAGAAAAGAAAGCCAAAATGGGTGCCTCAGGTGCCAGGACTAGCGACAAGGAGCCCACATGGGTATTGGAGGGCAAGAAGCTTGTCAAAGTCAGGGAGTTCAAGGGTAAACAATATGTGGATATCCGGGAGTTCTATGAGAAGAATGGTGACTTGCTGCCTGGCAAGAAGGGAATCAGTCTGACTCCAGAGCAGTGGCGGAAGCTGCTGTCCCTAGCGGAGGAGGTCAATGAGACCGTCAGCAGTAGATGTTAG
- Protein Sequence
- MPKHKKKEESSSDSDEGPVDRNVPPEKKAKMGASGARTSDKEPTWVLEGKKLVKVREFKGKQYVDIREFYEKNGDLLPGKKGISLTPEQWRKLLSLAEEVNETVSSRC*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00289643; iTF_00654317; iTF_00155329; iTF_00325412; iTF_00663109; iTF_00022822; iTF_01135784; iTF_00021355; iTF_00178192; iTF_00156273; iTF_01463284; iTF_00342229; iTF_01437078; iTF_00026882; iTF_01134818; iTF_00411491; iTF_00411492; iTF_00410312; iTF_00412537; iTF_00409312; iTF_00656172; iTF_00657235; iTF_00659475; iTF_00660346; iTF_00658429; iTF_00462420; iTF_00723990; iTF_00871320; iTF_01133756;
- 90% Identity
- iTF_00289643; iTF_00654317; iTF_00656172; iTF_00657235; iTF_00659475; iTF_00660346; iTF_00658429;
- 80% Identity
- -