Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.14 1.2e+03 0.3 0.7 7 20 6 19 3 31 0.64

2 4 0.63 5.6e+03 -1.9 0.1 54 61 29 36 22 43 0.70

3 4 6.2e-14 5.5e-10 39.8 10.2 6 70 75 141 70 141 0.91

4 4 0.75 6.7e+03 -2.1 0.0 46 56 156 166 154 168 0.77

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.14	1.2e+03	0.3	0.7	7	20	6	19	3	31	0.64
2	4	0.63	5.6e+03	-1.9	0.1	54	61	29	36	22	43	0.70
3	4	6.2e-14	5.5e-10	39.8	10.2	6	70	75	141	70	141	0.91
4	4	0.75	6.7e+03	-2.1	0.0	46	56	156	166	154	168	0.77

Coding Sequence: ATGGTTTTAAACGCTCGATGTCGAACATGTGGTGAAACTTTTGAACATAAGGTAGAATGTCAGTCTTTATTAGGTAGACATGCAAACATTCAACATCCATGCTCAAACATATCACATTATACTTGTAAATTACACCCTGGAAAagattttaaaagatttaattgtaaaaaaaataagaaaggtCGTAAAACaaTTGAATGTTGGAAACCAGGATGTGGACCTTTACATTGTCCAACGTGTTGTTTAGATGTTACACCTATTATAAGGAGACGCAGAAATAAAATTGCAAGTACATTTTGTGGAGCTTTAATAGTATTAGGATGTTGGCCCCTATGTTTTTTACCATTTGTTTTAAGTGGTTTCGATCAAAGCAATATATTCTTATATTGTCCATGTTGTATGCACTATTTAGGTAGATACAAGCGACGCGAGGGTGTTGTAATCTTGGAAACTGATAAAATTCGTCCATGTTGTGTTCGTGAAAATAATGATAAAGAAAAATTCCATCTGTAA
Protein Sequence: MVLNARCRTCGETFEHKVECQSLLGRHANIQHPCSNISHYTCKLHPGKDFKRFNCKKNKKGRKTIECWKPGCGPLHCPTCCLDVTPIIRRRRNKIASTFCGALIVLGCWPLCFLPFVLSGFDQSNIFLYCPCCMHYLGRYKRREGVVILETDKIRPCCVRENNDKEKFHL

Sequence clustering based on sequence similarity using MMseqs2