Nscu021352.1
Basic Information
- Insect
- Nephrocerus scutellatus
- Gene Symbol
- Dsp1_1
- Assembly
- GCA_947095585.1
- Location
- OX352763.1:27166457-27169517[+]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.3e-06 0.0038 18.8 3.8 44 68 3 27 1 28 0.95 2 2 1.1e-24 1.8e-21 77.5 1.3 1 69 50 118 50 118 0.99
Sequence Information
- Coding Sequence
- ATGGTAGACAAAGAGAAGAAACGATTCCATGAAATGGCCGAAAAAGACAAGGCGCGATATGAAATGGAAATGCAGAACTATGTTCCCCCCAAAGGTGTTGTTGTTGGCCGAGGAAAGAAAAGGAAACAAATTAAGGACCCGAATGCACCAAAAAGATCATTATCGGCATTCTTCTGGTTCTGCAATGATGAACGCAACAAGGTTAAGGCTTTGAATCCAGAATACGGTGTTGGCGACATTGCCAAAGAACTTGGCAGAAAATGGTCCGATGTCGAACCGGAGACAAAACAGAAATATGAATTAATGGCCGAAAAGGATAAGGCGCGTTACGAAAGGGAAATGACGGATTACAAAACCAGCGGGAAAATCGCAATGTCTGCGCCGTCAATGCAAGCCCAAGCGCAAGCAGCGCAGAAGGCGGCGTTACTTGCCGCCGCTGCAGCGCAACAGCAGCTTCatgatgaccatgatgatgacgatggtgacggagatgatgatgaAAATCAGTAG
- Protein Sequence
- MVDKEKKRFHEMAEKDKARYEMEMQNYVPPKGVVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEYGVGDIAKELGRKWSDVEPETKQKYELMAEKDKARYEREMTDYKTSGKIAMSAPSMQAQAQAAQKAALLAAAAAQQQLHDDHDDDDGDGDDDENQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00688641; iTF_01521057; iTF_01521857; iTF_00991780; iTF_00670917; iTF_00976454; iTF_00671566; iTF_01396486; iTF_00426311; iTF_00664045; iTF_00974639; iTF_00694608; iTF_00693810; iTF_00893854; iTF_00665607; iTF_01223399; iTF_01541415; iTF_00312587; iTF_01253867; iTF_01116430; iTF_00310227; iTF_00091211; iTF_01044685; iTF_01211917; iTF_00984210; iTF_01356852; iTF_00188082; iTF_00240725; iTF_01175061; iTF_00817389; iTF_00992566; iTF_01189391; iTF_00748184; iTF_01376609; iTF_00350146; iTF_00679458; iTF_00435523; iTF_00760067; iTF_00258853; iTF_00891845; iTF_01019398; iTF_01176902; iTF_00716679; iTF_00199848; iTF_00747432; iTF_01236648; iTF_01374920; iTF_01201577; iTF_00997707; iTF_01194379; iTF_00081196; iTF_01259182; iTF_01074448; iTF_01162224; iTF_01260976; iTF_01313777; iTF_01315473; iTF_00370994; iTF_01235698; iTF_01174227; iTF_01231540; iTF_01312981; iTF_00892727; iTF_01427447; iTF_00082904; iTF_01165496; iTF_01398457; iTF_00655291; iTF_01045435; iTF_01237627; iTF_01397404; iTF_00259742; iTF_01109310; iTF_01137982; iTF_01374046; iTF_01399424; iTF_00672188; iTF_01002748; iTF_01300000;
- 90% Identity
- iTF_01521057; iTF_01521857; iTF_00991780; iTF_01395812; iTF_00240725; iTF_00688641; iTF_00976454; iTF_01396486; iTF_00426311; iTF_00665607; iTF_00664045; iTF_01211917; iTF_00974639; iTF_00694608; iTF_00188082; iTF_00693810; iTF_00984210; iTF_01356852; iTF_01002748; iTF_00893854; iTF_01223399; iTF_01541415; iTF_00312587; iTF_01253867; iTF_01116430; iTF_00310227; iTF_01044685; iTF_00672819; iTF_00670917; iTF_00671566; iTF_00672188; iTF_00891845; iTF_01175061; iTF_00817389; iTF_01176902; iTF_01376609; iTF_00350146; iTF_00435523; iTF_00760067; iTF_00258853; iTF_00716679; iTF_00199848; iTF_01236648; iTF_01201577; iTF_00997707; iTF_01194379; iTF_01259182; iTF_01074448; iTF_01162224; iTF_01260976; iTF_01313777; iTF_01315473; iTF_00370994; iTF_01235698; iTF_01174227; iTF_01312981; iTF_00892727; iTF_01427447; iTF_01165496; iTF_01398457; iTF_00655291; iTF_01237627; iTF_01397404; iTF_00259742; iTF_01109310; iTF_01137982; iTF_01374046; iTF_01399424; iTF_01300000;
- 80% Identity
- -