Ntra019663.1
Basic Information
- Insect
- Neocrepidodera transversa
- Gene Symbol
- -
- Assembly
- GCA_963243735.1
- Location
- OY725342.1:9404343-9408439[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.0069 3.6e+02 2.9 0.0 23 37 113 127 102 140 0.71 2 5 0.15 7.8e+03 -1.4 0.0 27 44 146 163 144 167 0.84 3 5 0.00013 6.6 8.4 0.7 22 45 169 192 162 195 0.88 4 5 6.5e-06 0.34 12.5 0.1 21 52 196 227 192 227 0.88 5 5 0.00047 24 6.6 0.0 21 48 224 251 222 257 0.87
Sequence Information
- Coding Sequence
- ATGGATGAGGACGATTTTCATTCTTCCCTTGAACCCATGGTTATTATAAATGACGAAGAAGATAGCATACAACAGGATTTTAATATCAATGTGGTTGATCCACTGaccaaaactaataaaataattaattccttTGGTCCTGAAATTTCAATAACACCTGTTAAGAAAAAGCCTACTTTTAAAATAAGACTgtttgaaaaagaatattctCCATCCGAAGACGATACCAGTAATAAAGTCCAAAGTATTACAAGATCTCCACGAGAAAAAGTACGACTTGTTACCAAAGATGAAGCTTTAAATGCAGAAGAAACGTACACGAAGAGAAGATCAAATCCTTTAGAAAAATGTCcgatatgtaaaaaatttttccgGAGAATGAAAACCCATCTTTTGAAACATGACATTTTGGTTAAACCCGATGATTTATTATGTTGTACGTTgtgccaaaaagttttttttacccAGAGTAATCTTGCCATTCATATGAAAAGTCATAATGGTGATAGACCTTATAACTGcgaaatttgcaataaatgtTTTTCGCAGAGTTGTAATTTGGTGAACCATATGAGAGTGCatacaggagaaaaaccatttaaatgtCCTCACTGCGACAGGGCTTTTACCCAATCCGGTAATTTGAACAACCACATAAGGCTTCACACTGATGAAAAACCATTCAAATGTCATTTTTGTGATAAAGCCTTCGTCCAATCAGGTAACCTTGGTTCACATATAAGAAACAATCATAAATTTGCTGAAGGATCTTCATCAATGCCTTTATCAatgatgtaa
- Protein Sequence
- MDEDDFHSSLEPMVIINDEEDSIQQDFNINVVDPLTKTNKIINSFGPEISITPVKKKPTFKIRLFEKEYSPSEDDTSNKVQSITRSPREKVRLVTKDEALNAEETYTKRRSNPLEKCPICKKFFRRMKTHLLKHDILVKPDDLLCCTLCQKVFFTQSNLAIHMKSHNGDRPYNCEICNKCFSQSCNLVNHMRVHTGEKPFKCPHCDRAFTQSGNLNNHIRLHTDEKPFKCHFCDKAFVQSGNLGSHIRNNHKFAEGSSSMPLSMM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01047756; iTF_00387541; iTF_00792471;
- 90% Identity
- iTF_01047756;
- 80% Identity
- iTF_01047756;