Basic Information

Transcription Factor Domain

TF Family: TSC22
Domain: TSC22 domain
PFAM: PF01166
TF Group: Basic Domians group
Description: These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Drosophila protein bunched [1] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 3.4e-05 0.39 11.8 0.1 24 53 6 35 1 41 0.61

2 3 1.1e-05 0.12 13.4 0.2 18 55 35 72 29 74 0.89

3 3 0.0032 36 5.5 0.0 24 46 76 98 68 114 0.49

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	3.4e-05	0.39	11.8	0.1	24	53	6	35	1	41	0.61
2	3	1.1e-05	0.12	13.4	0.2	18	55	35	72	29	74	0.89
3	3	0.0032	36	5.5	0.0	24	46	76	98	68	114	0.49

Coding Sequence: ATGAAAGTGAGGTGCACTCAGCTGAAAGCGAAGTGCTCTCAGTTGAAAGCGAAGTGCACTCAGCTGAAAGCGAAGTGCGCTCAGCTGAAAGTGAAGTGCGCTCAGCTGAAAGTGAGGTGCGCTCAGCTGAAAGCGAGGTGCTCTCAGCTGAAAGTGAAGTGCGCTCAGCTGAAAGCGAGGTGCGCTCAGCCCAAATTGAGGTGCGCTCAGCTGAAAGTGAGGTGCGCTCAACTGAAAGTTAGGTGCGCTCCGCTGAAAGTGAAGTGCGCTCAGCTGAAAGTGAGGTGCGCTCAGCTGAATGTGAGGTGCGCTCCGCTGAAAGTGAGGTGCACTCAGCAGATGCGCTTTGATTGA
Protein Sequence: MKVRCTQLKAKCSQLKAKCTQLKAKCAQLKVKCAQLKVRCAQLKARCSQLKVKCAQLKARCAQPKLRCAQLKVRCAQLKVRCAPLKVKCAQLKVRCAQLNVRCAPLKVRCTQQMRFD

Sequence clustering based on sequence similarity using MMseqs2