Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0064 1.7e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 6 0.31 8.3e+03 -2.9 0.1 15 17 26 28 25 29 0.76

3 6 0.026 6.8e+02 0.6 0.4 12 15 33 36 31 37 0.93

4 6 1.2e-09 3.3e-05 24.0 3.8 4 22 53 71 51 71 0.90

5 6 0.63 1.7e+04 -3.8 6.9 10 15 82 87 81 88 0.83

6 6 1 2.7e+04 -5.1 1.7 6 9 92 95 91 96 0.74

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0064	1.7e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	6	0.31	8.3e+03	-2.9	0.1	15	17	26	28	25	29	0.76
3	6	0.026	6.8e+02	0.6	0.4	12	15	33	36	31	37	0.93
4	6	1.2e-09	3.3e-05	24.0	3.8	4	22	53	71	51	71	0.90
5	6	0.63	1.7e+04	-3.8	6.9	10	15	82	87	81	88	0.83
6	6	1	2.7e+04	-5.1	1.7	6	9	92	95	91	96	0.74

Coding Sequence: ATGTCTGATGACGGATCAGCAGTTGTTGAAAAGAAGGGTCGTGGAAGACCTAAAGCAAATGGAACTCCAGCTGAGCCAAAAGGAGACATTAAGAAGAGAGGACGGCCTGCAGCACCTGCTAAGGTTAAGGAATCTGCAAAGTCCTCTGATGATGAACAGGCACCAGCAGCAAAGAGAGGACGAGGCAGACCTAAAGGTTCAAAAAAGAGAGGCCCTGCTAAAGGAAAGGCGGGTGGTGAGGGAAGAGGTCGCGGCCGGCCGCGTAAGGACGCCCCTCCTCCCAAGAAGGACGCCGGTTCCACTGAGGAAGAACAAGACGAAGATGAGGACGAAGAAGGCTCTGACCAGTAA
Protein Sequence: MSDDGSAVVEKKGRGRPKANGTPAEPKGDIKKRGRPAAPAKVKESAKSSDDEQAPAAKRGRGRPKGSKKRGPAKGKAGGEGRGRGRPRKDAPPPKKDAGSTEEEQDEDEDEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2