Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 2.3e-07 2.4e-05 24.3 0.4 55 109 8 63 1 64 0.87

2 4 0.027 2.8 7.9 0.2 81 108 76 103 66 105 0.85

3 4 0.028 3 7.9 0.1 81 109 117 145 107 146 0.87

4 4 4.6 4.9e+02 0.8 0.0 81 109 149 177 144 178 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	2.3e-07	2.4e-05	24.3	0.4	55	109	8	63	1	64	0.87
2	4	0.027	2.8	7.9	0.2	81	108	76	103	66	105	0.85
3	4	0.028	3	7.9	0.1	81	109	117	145	107	146	0.87
4	4	4.6	4.9e+02	0.8	0.0	81	109	149	177	144	178	0.85

Coding Sequence: ATGGAAAATGAAGTTATAACAAAACTAGAAGTGAAGGACTTTGATGTAATGAAAGAaatgttaaattatatttattcggGAGAAACAAATGAAGTAAGTTATAGTGCATGCATANNNNTATTAAAAGCGGCTTCTGACTATCAACTTGAAGGATTAAAAGAACTTATTGAAAACAAGCTTTGTGATAATCTGaagatgattaaaaataactcaacTAACATTTATCAGATGACTAAGAATCTATTAGTCATAGCTCATGACTTCcatcttaaaaaattgaaaactttgtGCGAAGAGATCTTTCAAGAATGTCTGCTAACAGCTGAATTGACAGCTGTGGATCAGATAAAGATGTCGAAGGACTTATTAGTGGAGGCTCATAAGTATGAACTTGGAGTATTGAAAACGCTATGCGAAACTAGTCTTTGCGAAAAACTAGacattgaaaatgttttggAACGCTTTAATCTAGCATACCTCTACAAGGGTGATGAGCTCAAAAAAGCAACtattaactttattataaaaaataaaaaagcactggtcaatcaatcaaaattcAGTGACATCATCAAAGATATGGACATAAATGTAATGGCCGAAGTATGCCGTGTGCTAATAATGAAGAGTAAATCCCACGATAgcagcaaataa
Protein Sequence: MENEVITKLEVKDFDVMKEMLNYIYSGETNEVSYSACIXXLKAASDYQLEGLKELIENKLCDNLKMIKNNSTNIYQMTKNLLVIAHDFHLKKLKTLCEEIFQECLLTAELTAVDQIKMSKDLLVEAHKYELGVLKTLCETSLCEKLDIENVLERFNLAYLYKGDELKKATINFIIKNKKALVNQSKFSDIIKDMDINVMAEVCRVLIMKSKSHDSSK

Sequence clustering based on sequence similarity using MMseqs2