Mcer019793.1
Basic Information
- Insect
- Myzus cerasi
- Gene Symbol
- -
- Assembly
- None
- Location
- Mc1767:1165-1734[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.00023 2.1 9.1 0.5 21 43 41 63 31 68 0.86 2 5 0.00034 3.2 8.6 0.2 21 37 69 85 64 94 0.80 3 5 0.0087 81 4.1 0.2 21 45 97 121 90 124 0.80 4 5 0.0021 19 6.1 0.3 18 40 122 144 120 152 0.74 5 5 0.00039 3.7 8.4 0.1 22 48 154 179 147 183 0.83
Sequence Information
- Coding Sequence
- ATGAACGAACCTACATGTCGTGAGAGGAAGCGCGTGCCCAATAAACTATACTCTTGTGACACATGCCACAAATCGTTCAGATACAATGGCCTACTGACGAATCACAAGCGGATGCACTCTGGAGAGAAGCCGTACCAGTGTAATGTATGCAACTCGCATTTCTCCCAGAGCAGTAGCCTGTCCAGACATAAGAGGACGCACACCGGGGAGAAGCCATACACGTGTGACGTATGCTACACATCGTTCGCTCAAAGATATATCCTGGTGGTTCACAAGCGGACGCACTCTGGAGAGAAGCCTTTCCGGTGTGCCTCGTGCGACTTATCTTTCGCCCAGAACAGTAGCCTGACCAGGCATATCAGGAGGCACACTGGGGAGAAGCCATACACGTGTGCCATTTGTGATAAGTCTTTCTCTCTGAGGAGTAACCTAACAGTTCATCAGAGGACGCACACGGGAGATAAGCCGTATTCGTGTGAAATATGTAACAGATCGTTTAGTCAGAGTGGCAACCTTGCGGCACACAAACTGACCCACACAGCTGCTGACATGCTTAAAATCATCCTCTAA
- Protein Sequence
- MNEPTCRERKRVPNKLYSCDTCHKSFRYNGLLTNHKRMHSGEKPYQCNVCNSHFSQSSSLSRHKRTHTGEKPYTCDVCYTSFAQRYILVVHKRTHSGEKPFRCASCDLSFAQNSSLTRHIRRHTGEKPYTCAICDKSFSLRSNLTVHQRTHTGDKPYSCEICNRSFSQSGNLAAHKLTHTAADMLKIIL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01032372;
- 90% Identity
- iTF_01032372;
- 80% Identity
- iTF_01032372;