Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.00023 2.2 9.1 0.2 21 43 41 63 32 68 0.86

2 8 0.0018 17 6.2 0.0 21 43 69 91 64 96 0.87

3 8 0.00033 3.1 8.6 0.1 20 43 96 119 90 124 0.87

4 8 0.00044 4.1 8.2 0.1 21 43 125 147 120 151 0.90

5 8 0.0015 14 6.5 0.3 21 33 153 165 148 175 0.83

6 8 0.01 94 3.9 0.2 22 43 185 207 174 208 0.50

7 8 0.00018 1.7 9.5 0.2 18 44 206 232 204 240 0.86

8 8 0.0051 48 4.8 0.1 22 48 238 263 232 267 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.00023	2.2	9.1	0.2	21	43	41	63	32	68	0.86
2	8	0.0018	17	6.2	0.0	21	43	69	91	64	96	0.87
3	8	0.00033	3.1	8.6	0.1	20	43	96	119	90	124	0.87
4	8	0.00044	4.1	8.2	0.1	21	43	125	147	120	151	0.90
5	8	0.0015	14	6.5	0.3	21	33	153	165	148	175	0.83
6	8	0.01	94	3.9	0.2	22	43	185	207	174	208	0.50
7	8	0.00018	1.7	9.5	0.2	18	44	206	232	204	240	0.86
8	8	0.0051	48	4.8	0.1	22	48	238	263	232	267	0.83

Coding Sequence: ATGAACGAACCTACATGTCGTGAGAGGAAGTGCGTGCCCAATAAACTATACTCTTGTGACACATGCCACAAATCGTTCAGATACAATGGCCTACTGACGAATCACAAGCGGATGCACTCTGGAGAGAAGCCGTACCAGTGTAATGTATGCAACTCGCATTTCTCCCAGGGCAGTAACCTGTCCAGACATAAGAGGACGCACACCGGGGAGAAGCCATACACGTGTGACGTATGCAACTCGCATTTCTCCCAGGGCAGTAGCCTGTCCAAACATAAGAGGACGCACACCGGGGAGAAGCCATACACGTGTGACGTATGCAACTCGCATTTCTCCCAGGGCAGTAGCCTGTCCAGACATAAGAGGACGCACACCGGGGAGAAGCCATACACGTGTGACGTATGCAACTCGCATTTCTCCCAGGGCAGTAGCCTGTCCAGACATAAGAGGACGCACACCGGGGAGAAGCCATACACGTGTGACGTATGCTACACATCGTTCGCTCGAAGATATATCCTGATGGTTCACAAGCGGACGCACTCTGGAGAGAAGCCTTTCCAGTGTGCCTCGTGCGACTTATCTTTCGCCCAGAACATTAGCCTGACCAGGCATATCAGGAGGCACACTGGGGAGAAGCCATACACGTGTGCCATTTGTGATAAGTCTTTCTCTCAGAGGAGTAACCTAACAGTTCATCAGAGGACGCACACGGGAGATAAGCCGTATTCGTGTGAAATATGTAACAGATCGTTTAGTCAGAATGGCAACCTTGCGGCACACAAACTGACCCACACAGCTGCTGACATGCTTAAAATCATCCTCTAA
Protein Sequence: MNEPTCRERKCVPNKLYSCDTCHKSFRYNGLLTNHKRMHSGEKPYQCNVCNSHFSQGSNLSRHKRTHTGEKPYTCDVCNSHFSQGSSLSKHKRTHTGEKPYTCDVCNSHFSQGSSLSRHKRTHTGEKPYTCDVCNSHFSQGSSLSRHKRTHTGEKPYTCDVCYTSFARRYILMVHKRTHSGEKPFQCASCDLSFAQNISLTRHIRRHTGEKPYTCAICDKSFSQRSNLTVHQRTHTGDKPYSCEICNRSFSQNGNLAAHKLTHTAADMLKIIL

Sequence clustering based on sequence similarity using MMseqs2