Mlor015864.1
Basic Information
- Insect
- Mythimna loreyi
- Gene Symbol
- -
- Assembly
- GCA_029852875.1
- Location
- CM056793.1:6265211-6267055[+]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 1.2e-12 1.2e-09 39.3 2.3 1 68 51 118 51 119 0.97 2 3 8.6 8.6e+03 -1.9 0.8 56 65 141 150 126 153 0.58 3 3 2.8e-08 2.8e-05 25.3 6.0 1 63 156 214 156 218 0.89
Sequence Information
- Coding Sequence
- atgtccTCTTTTACTCAGATTTCTCGATTGACTAATTACTTCGTTGGTAGTTATAAAAGTGTTCTACATGGGAGAACAAACTGGCTGGCTCCGGTTCAAGCATGTAGCTATACAAAGAAGTCGGCAGAAGAGAGGCTGGGCTTAGACAAGCCTAAGCGACCTCTGACTCCATTTTTCAAGTTTATGACACAGATGAGGCCAGCCCTCCTGGCCAAAAACCCAGGCATTTCTTCCAAGGAGGCCATTGCCTGGACATCTAAACACTGGCAGCAGTTGGATTTAGAAACCAAAGCTCAAATGGGAAAGGAATATGAAAAAGATTTAGAAGACTATAAGAAAATCAAGGCAATGTATGAATCTTCattgacagacaaacaaaaGGAAGACATCAAAAGGATAAAACTTGAATTGGCTGAGGCAAAGGAGAAGAGAAAACTAAAAGCTGAATACAAAGAGCTTGGACGTCCGAAAAAGCCAATGTCATCATATTTCCTCTTTATTCAATCTAGAAAGGAAGGATTCAAAGGCAAagacttaaaacaatatcaaGAACAAGTAAAGAAAGAATGGGTAAAATTAACTGAAACTGAAAAGGCTAAGTTTGATAAACAGGCTGCTGAGCTAATGGCTAAATACAGCTCTTATTGTCCTGCTGCTGGGCAAAGCCTCTCCCTAAGCCCTTCCAAATTCTTAGCTTCCTGGACCCCAGAGCCACCTGTCTATGCCAGCACAACCCCTGATATCACTGGGCACTAG
- Protein Sequence
- MSSFTQISRLTNYFVGSYKSVLHGRTNWLAPVQACSYTKKSAEERLGLDKPKRPLTPFFKFMTQMRPALLAKNPGISSKEAIAWTSKHWQQLDLETKAQMGKEYEKDLEDYKKIKAMYESSLTDKQKEDIKRIKLELAEAKEKRKLKAEYKELGRPKKPMSSYFLFIQSRKEGFKGKDLKQYQEQVKKEWVKLTETEKAKFDKQAAELMAKYSSYCPAAGQSLSLSPSKFLASWTPEPPVYASTTPDITGH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01338762;
- 90% Identity
- iTF_00121444; iTF_00042629; iTF_00039814; iTF_01119335; iTF_00043498; iTF_01118314; iTF_00111664; iTF_00040817; iTF_00038774; iTF_00711865; iTF_00302107; iTF_00745701; iTF_00907048; iTF_01026185; iTF_01027329; iTF_00888264; iTF_01031145; iTF_00449107; iTF_01029268; iTF_01230588; iTF_00374122; iTF_00375221; iTF_01246986; iTF_00622832; iTF_00071435; iTF_00906155; iTF_01192718; iTF_00124271; iTF_01532016; iTF_01062803; iTF_00685442; iTF_01061893; iTF_01063764; iTF_00301173; iTF_01064666; iTF_00771925; iTF_00667491; iTF_01526022; iTF_00907883; iTF_00952716; iTF_00036725; iTF_00973783; iTF_00300216; iTF_00951834; iTF_00831227; iTF_00172957; iTF_01527230; iTF_00850742; iTF_00851801; iTF_01030230; iTF_01533048; iTF_01534830; iTF_01533935; iTF_00037817; iTF_00147460; iTF_01094041; iTF_01093100; iTF_00726362; iTF_00924684; iTF_00274427; iTF_00758171; iTF_00123378; iTF_00364029; iTF_00122398; iTF_00120512; iTF_01439936;
- 80% Identity
- -