Mlon024706.1
Basic Information
- Insect
- Mystacides longicornis
- Gene Symbol
- -
- Assembly
- GCA_963576905.1
- Location
- OY756430.1:26561434-26561958[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.0031 69 4.9 0.2 21 48 6 33 4 37 0.78 2 6 3.3e-05 0.72 11.3 0.1 21 52 34 65 16 66 0.87 3 6 0.0013 28 6.2 0.0 21 52 62 93 58 94 0.86 4 6 0.0015 33 6.0 0.0 21 51 90 120 88 121 0.86 5 6 4e-05 0.88 11.0 0.1 21 52 118 149 115 149 0.89 6 6 0.00013 2.8 9.4 0.0 21 46 146 171 143 173 0.90
Sequence Information
- Coding Sequence
- atgctactgcatagcggagaacagCCGTACAAGTGTAAGATTTGTAGTAAAAAGTCCAATCATTTTAGTGcattaaagatacacatgcgactgcatagcggagaaaagccatacgagtgtacaATTTGCAGTAAGAAGTTCACTCAATCTcctcatttaaagacacacatgcgactgcatagcggagaaaagccatacgagtgtacaatttgcagtaaaaagttcactcgatctgatgctttaaagatacacatgctactgcatagcggagaaaagccatacgagtgtacaatttgcagtaaaaagttcactcactctggtactttaaagacacacatgctactccatagcggagaaaagccgtacaagtgtaatatttgcagtaaaaagttcacacaatctcatcatttaaagatacacatgcgacttcatagcggagaaaagccatacgagtgtacaatttgcagtaaaaagttcactcaatctcatcatttaaagacacacatgctactgcatagcggataa
- Protein Sequence
- MLLHSGEQPYKCKICSKKSNHFSALKIHMRLHSGEKPYECTICSKKFTQSPHLKTHMRLHSGEKPYECTICSKKFTRSDALKIHMLLHSGEKPYECTICSKKFTHSGTLKTHMLLHSGEKPYKCNICSKKFTQSHHLKIHMRLHSGEKPYECTICSKKFTQSHHLKTHMLLHSG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01025295;
- 90% Identity
- iTF_01025295;
- 80% Identity
- iTF_01025295;