Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0031 69 4.9 0.2 21 48 6 33 4 37 0.78

2 6 3.3e-05 0.72 11.3 0.1 21 52 34 65 16 66 0.87

3 6 0.0013 28 6.2 0.0 21 52 62 93 58 94 0.86

4 6 0.0015 33 6.0 0.0 21 51 90 120 88 121 0.86

5 6 4e-05 0.88 11.0 0.1 21 52 118 149 115 149 0.89

6 6 0.00013 2.8 9.4 0.0 21 46 146 171 143 173 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0031	69	4.9	0.2	21	48	6	33	4	37	0.78
2	6	3.3e-05	0.72	11.3	0.1	21	52	34	65	16	66	0.87
3	6	0.0013	28	6.2	0.0	21	52	62	93	58	94	0.86
4	6	0.0015	33	6.0	0.0	21	51	90	120	88	121	0.86
5	6	4e-05	0.88	11.0	0.1	21	52	118	149	115	149	0.89
6	6	0.00013	2.8	9.4	0.0	21	46	146	171	143	173	0.90

Coding Sequence: atgctactgcatagcggagaacagCCGTACAAGTGTAAGATTTGTAGTAAAAAGTCCAATCATTTTAGTGcattaaagatacacatgcgactgcatagcggagaaaagccatacgagtgtacaATTTGCAGTAAGAAGTTCACTCAATCTcctcatttaaagacacacatgcgactgcatagcggagaaaagccatacgagtgtacaatttgcagtaaaaagttcactcgatctgatgctttaaagatacacatgctactgcatagcggagaaaagccatacgagtgtacaatttgcagtaaaaagttcactcactctggtactttaaagacacacatgctactccatagcggagaaaagccgtacaagtgtaatatttgcagtaaaaagttcacacaatctcatcatttaaagatacacatgcgacttcatagcggagaaaagccatacgagtgtacaatttgcagtaaaaagttcactcaatctcatcatttaaagacacacatgctactgcatagcggataa
Protein Sequence: MLLHSGEQPYKCKICSKKSNHFSALKIHMRLHSGEKPYECTICSKKFTQSPHLKTHMRLHSGEKPYECTICSKKFTRSDALKIHMLLHSGEKPYECTICSKKFTHSGTLKTHMLLHSGEKPYKCNICSKKFTQSHHLKIHMRLHSGEKPYECTICSKKFTQSHHLKTHMLLHSG

Sequence clustering based on sequence similarity using MMseqs2