Mdei025908.1
Basic Information
- Insect
- Morpho deidamia
- Gene Symbol
- -
- Assembly
- GCA_029101505.1
- Location
- JAPJRL010000029.1:787440-795281[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 2.1e-05 0.6 10.9 0.0 22 48 12 37 9 41 0.89 2 4 0.19 5.6e+03 -1.8 0.0 27 48 46 67 44 73 0.73 3 4 9.3e-05 2.7 8.9 0.0 25 48 75 98 65 100 0.85 4 4 0.0026 75 4.2 0.2 26 45 105 124 102 134 0.74
Sequence Information
- Coding Sequence
- atgcttgtgtattgtggtggcggtggtggagGCGAGAAGCCGTTCAAGTGCAAGTTTTGTAGCTACGCGTGCAGAGACAGTTCTACCCTGAGGAAGCACCAGGAGCGGCATATGGGCGTCACCAGGTTCTACCAGTGCACTGCCTGCGATAAAAGCTACAAAACCAAGAGGGTGTTGAAGGTCCACGTGGGTCAAGCCCACATGGACCAGGACATGAAGACGAAGCCGTGCCCACTCTGTGGGAAGATGTTCGCGACCAGCAAAAACCTCACCAACCATATTAGAGTATTCCACGAGAGGTTGTATGAATGCAAATGCGACATATGCGGTATGAAATTGGCGAACAAATACAATATGAGGGCGCATCTCAACAAGCACATGGACTTACGACCATTTACGTGCACATTCGAGGGATGCaataagaaatttaaagatAAGGTAAGATAG
- Protein Sequence
- MLVYCGGGGGGEKPFKCKFCSYACRDSSTLRKHQERHMGVTRFYQCTACDKSYKTKRVLKVHVGQAHMDQDMKTKPCPLCGKMFATSKNLTNHIRVFHERLYECKCDICGMKLANKYNMRAHLNKHMDLRPFTCTFEGCNKKFKDKVR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01018931;
- 90% Identity
- iTF_01018931;
- 80% Identity
- iTF_01018931;