Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.079 40 5.2 0.1 83 108 25 50 18 52 0.90

2 4 0.0063 3.2 8.8 0.1 77 109 51 83 49 84 0.89

3 4 6e-18 3.1e-15 57.1 0.0 8 95 143 229 138 245 0.81

4 4 0.12 59 4.7 0.1 76 101 244 269 234 277 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.079	40	5.2	0.1	83	108	25	50	18	52	0.90
2	4	0.0063	3.2	8.8	0.1	77	109	51	83	49	84	0.89
3	4	6e-18	3.1e-15	57.1	0.0	8	95	143	229	138	245	0.81
4	4	0.12	59	4.7	0.1	76	101	244	269	234	277	0.81

Coding Sequence: ATGGATTGCATTGACCCAACAAAGAAGGCCAAAGAAGGCGAAGATCCATTTTCGAACAGAATTGTCCTCAGAATGATGGATGTTTATAGGTTGGCAGTGGAATTCAATATGGCACGATTAGAACAACTGTGTGTACAATATTTACACGCTACGATTTGTTTGAAAAATGTATTGGTGGCCCTACATAACGCTGATCATTTGCAGTTAGACTTCATTAAGGAACACTGTTTGAGATTCATTGTCAAAGAAAGTAACTACAATCAAATCGTTATGAGTTCCGAGTTTGAAAATTTGGAACGAAATTTGATGGTGGAAATAATTAGGAGAAAACAGATGCCTCAGTACAAGGCCAGCATGGAGACACAGCACTTTGATACAAACCGTTGCACTTTGGAACAAGACATGTGTATGTTTCTGCGTCTAACTGGAATAGAATTTTGCGATATCGACTTAAACCTAGATGGACACACAATCCCTGCGCATAAAACTATTTTAGCTGCACGATGTGGTTATTTCGAGGCCATGTTTAGGTCGTTTATGCCAGCAGACAGTAAAATTCAAATAGGTGAGATGATACCTTCTAAGGAATCATTTGATTCTTTGCTTCGATACATTTATTACGGTGATGTAGACATGCCTCCAGAAGACTCCCTTTATCTGTTTTCTGCCCCGTTTTTTTACGGTTTCACAAACAATCGACTACAAGCATTCTGCAAACAAAATCTAGAAATGAATGTCACGTTCGAGAATGTTATTCAAATCCTAGAAGCGGCCGATAAGATGCAGGCCACCGACATGAAAAAATATGCTTTGGATTTAATCGTGCACCACTTTACGAAAGTTTGCGAAATTACCACGGTTAAGGATGCTGAGCAAAGAGCTGATTCTCGATATTTTGGAAGTACTTGCAGAAAGTTTGGATAA
Protein Sequence: MDCIDPTKKAKEGEDPFSNRIVLRMMDVYRLAVEFNMARLEQLCVQYLHATICLKNVLVALHNADHLQLDFIKEHCLRFIVKESNYNQIVMSSEFENLERNLMVEIIRRKQMPQYKASMETQHFDTNRCTLEQDMCMFLRLTGIEFCDIDLNLDGHTIPAHKTILAARCGYFEAMFRSFMPADSKIQIGEMIPSKESFDSLLRYIYYGDVDMPPEDSLYLFSAPFFYGFTNNRLQAFCKQNLEMNVTFENVIQILEAADKMQATDMKKYALDLIVHHFTKVCEITTVKDAEQRADSRYFGSTCRKFG

Sequence clustering based on sequence similarity using MMseqs2