Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.00058 5.8 8.3 0.1 47 68 8 29 2 31 0.79

2 4 0.00052 5.2 8.4 0.1 47 68 37 58 30 60 0.82

3 4 0.0033 32 5.9 0.1 4 20 64 80 61 87 0.79

4 4 0.00052 5.2 8.4 0.1 47 68 85 106 78 108 0.79

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.00058	5.8	8.3	0.1	47	68	8	29	2	31	0.79
2	4	0.00052	5.2	8.4	0.1	47	68	37	58	30	60	0.82
3	4	0.0033	32	5.9	0.1	4	20	64	80	61	87	0.79
4	4	0.00052	5.2	8.4	0.1	47	68	85	106	78	108	0.79

Coding Sequence: ATGCTGGCTGCAGCAAGTCACTGTCGACTGCCCTGGCTGCAGCAAGTCACTGTCGACTGCCCTGGCTGCAGCAAGTCACTGTCGACTGCCCTGGCTGCAGCAAGTCACTGTCGACTGCCCTGGCTGCAGCAAGTCGTTGTCGACTGCCCTGGCTGCAGCAAGTCACTGTCGACTGCCCTGGCTGCAGCAAGTCATGTCGACTGCCCTGGCTGCAGCAAGTCACTGTCGACTGCCCTGGCTGCAGCAAGTCACTGTCGACTGCCCTGGCTGCAGCAAGTCACTGTCGACTGCCCTGGCTGCAGCAAGTCACTGTCGACTGCCCTGGCTGCAGCAGGTCACTGA
Protein Sequence: MLAAASHCRLPWLQQVTVDCPGCSKSLSTALAAASHCRLPWLQQVVVDCPGCSKSLSTALAAASHVDCPGCSKSLSTALAAASHCRLPWLQQVTVDCPGCSKSLSTALAAAGH*

Sequence clustering based on sequence similarity using MMseqs2