Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.0064 2.4e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 3 0.029 1.1e+03 0.4 0.5 12 15 36 39 35 40 0.92

3 3 2.6e-09 9.5e-05 23.0 3.1 4 22 56 74 54 74 0.92

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.0064	2.4e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	3	0.029	1.1e+03	0.4	0.5	12	15	36	39	35	40	0.92
3	3	2.6e-09	9.5e-05	23.0	3.1	4	22	56	74	54	74	0.92

Coding Sequence: ATGTCTGATGATGGCCAAGCTGTTGTGGAGAAGAAGGGACGCGGAAGGCCCAAGGCCAATGGCGCCACGAAGGAAGTCAAGGAGGTGAAAGGCGATGTTAAGAAACGCGGGAGGCCCACAGCTGCAGCCAAACCAGTAAAAGATTCGGCAAAATCGTCCGACGACGAACAGCCTGCGGCAAAAAGAGGACGAGGGCGCCCTAAGGGAACTAAGAAGAAGGGCGGAAAAGCTAAGGTTGTAGTTGCTGCAAATAAACTAAACTTAAATGACGGCCAGACCCTCGTTCCTACGGGCCTAATGCCCGCGATAGAGCCAATTCCCATGGCGTGCCAGGAAAGATATTTGCAATAA
Protein Sequence: MSDDGQAVVEKKGRGRPKANGATKEVKEVKGDVKKRGRPTAAAKPVKDSAKSSDDEQPAAKRGRGRPKGTKKKGGKAKVVVAANKLNLNDGQTLVPTGLMPAIEPIPMACQERYLQ

Sequence clustering based on sequence similarity using MMseqs2