Mmyr010293.1
Basic Information
- Insect
- Microdon myrmicae
- Gene Symbol
- bun
- Assembly
- GCA_963931805.1
- Location
- OZ007497.1:187750110-187750478[+]
Transcription Factor Domain
- TF Family
- TSC22
- Domain
- TSC22 domain
- PFAM
- PF01166
- TF Group
- Basic Domians group
- Description
- These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Drosophila protein bunched [1] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 4.3e-23 1.4e-18 67.6 6.8 9 57 1 49 1 49 0.98 2 3 0.1 3.3e+03 -0.8 0.3 42 54 66 78 60 79 0.77 3 3 1 3.3e+04 -5.7 5.4 52 54 96 98 83 106 0.49
Sequence Information
- Coding Sequence
- ATGATAGCCGTTCGCGAAGAAGTTGAAGTGCTTAAGGAGAAAATATCAGAACTTATGACTAAGATAAATCAATTAGAAGTAGAGAATAATCTCCTTAAAGCAAACATGTCCCAAGAGACTTTACATCAATTGCAAGCACAATTGCAAATAGCTGGAAGCGGTACAGGTGGTAATTTAATtgctcaacaacaacagcaaataACAGCACCACAACAATTTCAACAACTGCCAGCCCCGCCACCGGTTTCGCAACATCAACAACCGCAAtcacaacagcagcaacagcaaccacaacaacagcaacaacaacagcagatgGCTCCACAAGCTTATACTCCTGGCAATACAATCAATGGTCCAATGTCTTAA
- Protein Sequence
- MIAVREEVEVLKEKISELMTKINQLEVENNLLKANMSQETLHQLQAQLQIAGSGTGGNLIAQQQQQITAPQQFQQLPAPPPVSQHQQPQSQQQQQQPQQQQQQQQMAPQAYTPGNTINGPMS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -