Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.051 8.3e+02 1.6 0.3 25 36 118 129 109 139 0.71

2 5 0.2 3.3e+03 -0.3 0.0 26 51 143 168 135 171 0.72

3 5 0.0021 34 6.1 0.1 23 48 168 193 161 197 0.85

4 5 1.1e-05 0.18 13.3 0.0 21 52 194 225 190 225 0.89

5 5 0.00013 2.2 9.9 0.0 21 54 222 255 220 255 0.92

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.051	8.3e+02	1.6	0.3	25	36	118	129	109	139	0.71
2	5	0.2	3.3e+03	-0.3	0.0	26	51	143	168	135	171	0.72
3	5	0.0021	34	6.1	0.1	23	48	168	193	161	197	0.85
4	5	1.1e-05	0.18	13.3	0.0	21	52	194	225	190	225	0.89
5	5	0.00013	2.2	9.9	0.0	21	54	222	255	220	255	0.92

Coding Sequence: ATGGATTACAAGTGTGAAGAGACCTATGATGATATTCCTTTAGAACCAGTAACTTTAATGAATAATGGTGAAGAGGAAAATAGAAGTGCACCAAGTGAAAGTAATGAAGACAGTGACTCTGATTTAATCGAACCTTTTGTTCCCAATATTTCCTTTTTGCGTTTGAAAAGGAAAAAGCCTCTTTTCAAGATCAGGCTTTTCGATAAAAAATCAGCTGCATACAGGAAAAAATCATACTCTGTAGAAGATTCATCTGAAAGAAAATCTACAAGAGATAACATCAGAATAATAACGACTGATGAAGCTGAGCAGCATTCGGAACTATTCCAAAAACGTCAATCTCTTCCCCTAGAAAAATGTCCAAtatgtaataaatattttaGAAGAATGGCGACCCATCTATTGAAGCATAGTACTGATAATTTTATCTGTGATTTATGTAACAAATCTTTCAACACTCAAAGTAATCTTATGATGCACCTAAGAACACACACTGATTTAAAACCATATGTCTGTGAAGTATGCAGTAAGGGATTTTCACAATCTTGTAATTTAGTTAATCATATGAGGATACATAGTGGAGAAAAACCTTTCAAATGTCCACATTGTGATAAGGCATTCACACAATCTGGAAATTTGAATAATCATATTAGGCTACACACCAACGAGAAACCTTTCAAGTGTCATTTTTGTGACAAGGCGTTCATTCAATCAGGCAACTTGAATTCTCATATCAACAATAATCATAAAGACAAGCAAGGAATTAATCAAAACTTTGAACTTATTTCATCTGAGGCAATTTCATACCAAAATATTTGA
Protein Sequence: MDYKCEETYDDIPLEPVTLMNNGEEENRSAPSESNEDSDSDLIEPFVPNISFLRLKRKKPLFKIRLFDKKSAAYRKKSYSVEDSSERKSTRDNIRIITTDEAEQHSELFQKRQSLPLEKCPICNKYFRRMATHLLKHSTDNFICDLCNKSFNTQSNLMMHLRTHTDLKPYVCEVCSKGFSQSCNLVNHMRIHSGEKPFKCPHCDKAFTQSGNLNNHIRLHTNEKPFKCHFCDKAFIQSGNLNSHINNNHKDKQGINQNFELISSEAISYQNI

Sequence clustering based on sequence similarity using MMseqs2