Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.31 2.4e+02 3.7 0.0 27 52 2 27 1 28 0.87

2 6 1.4 1.1e+03 1.7 0.1 20 46 23 49 22 55 0.76

3 6 0.21 1.6e+02 4.3 0.0 22 45 53 76 49 83 0.86

4 6 0.043 33 6.5 0.0 22 48 81 107 78 112 0.83

5 6 0.016 12 7.9 0.1 23 52 110 139 106 140 0.85

6 6 0.013 9.8 8.2 0.1 22 44 137 159 134 168 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.31	2.4e+02	3.7	0.0	27	52	2	27	1	28	0.87
2	6	1.4	1.1e+03	1.7	0.1	20	46	23	49	22	55	0.76
3	6	0.21	1.6e+02	4.3	0.0	22	45	53	76	49	83	0.86
4	6	0.043	33	6.5	0.0	22	48	81	107	78	112	0.83
5	6	0.016	12	7.9	0.1	23	52	110	139	106	140	0.85
6	6	0.013	9.8	8.2	0.1	22	44	137	159	134	168	0.85

Coding Sequence: ATGTGTGAAGTTTGTGCAAAGAGCTTTACTCAAGCATCTagtttgaagaaacatcttttgattcatcagAGAATGAAGCCATATAAGtgcaaaatttgtggaaagaactttacTCAAACATCTCATTTGAGCGTACATACTTTGATTCATGAGtgcaagaaaccacataagtgCAAGGTATGTGAGAAGGGCTTTACTCATGCCTCTAATTTGAAAAAACATATTCTGATTCATGATGGCAAGAGGCCacacaaatgtgaaatttgtgggaagagctttactcagtcATCTAGTTTGAGGGGATATCTTCTTATACATGAGGGCAGGAAgccccataaatgtgaaatttgtgggaagagctttactcacaCATCTAATTTCAggaaacatcttttaattcatgaaggcaagaagcctcataagtgtgaaatttgtcaGAAAAGTTTTACTCACTCATCTAATTTGAAAAAGCATCATTTGATTCTTGAGGGCAAGAAGCCCCATAAGAGTTAA
Protein Sequence: MCEVCAKSFTQASSLKKHLLIHQRMKPYKCKICGKNFTQTSHLSVHTLIHECKKPHKCKVCEKGFTHASNLKKHILIHDGKRPHKCEICGKSFTQSSSLRGYLLIHEGRKPHKCEICGKSFTHTSNFRKHLLIHEGKKPHKCEICQKSFTHSSNLKKHHLILEGKKPHKS

Sequence clustering based on sequence similarity using MMseqs2