Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.011 8.2 8.4 0.1 21 51 10 40 6 42 0.84

2 7 0.19 1.4e+02 4.4 0.1 22 48 39 64 35 69 0.86

3 7 0.061 47 6.0 0.0 22 51 95 124 92 126 0.84

4 7 0.22 1.7e+02 4.2 0.1 22 51 123 152 120 154 0.83

5 7 0.64 4.9e+02 2.8 0.0 22 51 151 180 148 182 0.83

6 7 0.16 1.2e+02 4.7 0.0 22 47 179 204 175 209 0.84

7 7 0.19 1.5e+02 4.4 0.1 23 44 208 229 204 237 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.011	8.2	8.4	0.1	21	51	10	40	6	42	0.84
2	7	0.19	1.4e+02	4.4	0.1	22	48	39	64	35	69	0.86
3	7	0.061	47	6.0	0.0	22	51	95	124	92	126	0.84
4	7	0.22	1.7e+02	4.2	0.1	22	51	123	152	120	154	0.83
5	7	0.64	4.9e+02	2.8	0.0	22	51	151	180	148	182	0.83
6	7	0.16	1.2e+02	4.7	0.0	22	47	179	204	175	209	0.84
7	7	0.19	1.5e+02	4.4	0.1	23	44	208	229	204	237	0.88

Coding Sequence: ATGAGAAATTATCAGGTAATTAATGAGAGTTtaaagccacataagtgtgaaatttgtggaaagcgCTTTACCAGAACTTCTAATTTAAgagaacatcttttgattcatgagggtaagaaaccacataaatgtgaagtttgtgaaaagagTTTTAAACGGGCATCTCATTTAAGGGAACACCTTTTGAATCATCAGGGTAAGAATTCACATAAATGTAAAGAATGTGCGAAGAGCTTTACCTGGGCATCTCATTTAAGggatcatcttttgattcatgagggtaagaagccacataaatgtgaagtttgtgggaagagctttacacgGGTATCTAATTTAAgagaacatcttttgattcatgagggtgataaaccacataaatgtgaagtttgtgataaAAGCTTTACTCGTACATCTACCTTGAATAGACATCTCTTGATacacgagggtaagaaaccacataaatgtgaagtttgtggggaGAGTTTTACCCTTGCAGCTGGTTTGAAGaggcatcttttgattcatgaaggtaagaaaccacataaatgtggaGTTTGTGGGGAAAGCTTTACCCTTTCATCTGGGTTGaaaagacatcttttgattcatgtaGGTcataaaccacataaatgtgaaatttgtggggaGCGATTTACTCATTCTTCTAGTTTGAAGagacatttttttattcatgagCGTAAGAAaacacataaatgtgaattttgtggggAGAGCTTTACCCTTGCATCTgccttgaagaaacatctttttgTTCATAAGTGA
Protein Sequence: MRNYQVINESLKPHKCEICGKRFTRTSNLREHLLIHEGKKPHKCEVCEKSFKRASHLREHLLNHQGKNSHKCKECAKSFTWASHLRDHLLIHEGKKPHKCEVCGKSFTRVSNLREHLLIHEGDKPHKCEVCDKSFTRTSTLNRHLLIHEGKKPHKCEVCGESFTLAAGLKRHLLIHEGKKPHKCGVCGESFTLSSGLKRHLLIHVGHKPHKCEICGERFTHSSSLKRHFFIHERKKTHKCEFCGESFTLASALKKHLFVHK

Sequence clustering based on sequence similarity using MMseqs2