Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.014 10 8.1 0.0 22 47 73 98 70 103 0.84

2 7 0.081 62 5.6 0.0 22 52 101 131 98 132 0.86

3 7 1.6 1.3e+03 1.4 0.0 23 45 130 152 127 160 0.81

4 7 0.006 4.6 9.2 0.1 22 46 157 181 151 187 0.85

5 7 0.012 9 8.3 0.1 23 52 186 215 182 217 0.89

6 7 2.3 1.7e+03 1.0 0.1 22 46 213 237 210 245 0.82

7 7 6 4.6e+03 -0.4 0.0 22 46 269 293 265 297 0.78

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.014	10	8.1	0.0	22	47	73	98	70	103	0.84
2	7	0.081	62	5.6	0.0	22	52	101	131	98	132	0.86
3	7	1.6	1.3e+03	1.4	0.0	23	45	130	152	127	160	0.81
4	7	0.006	4.6	9.2	0.1	22	46	157	181	151	187	0.85
5	7	0.012	9	8.3	0.1	23	52	186	215	182	217	0.89
6	7	2.3	1.7e+03	1.0	0.1	22	46	213	237	210	245	0.82
7	7	6	4.6e+03	-0.4	0.0	22	46	269	293	265	297	0.78

Coding Sequence: ATGGAAGTCAAACTGGAAATAAAGGAGGAACCACTAGACAATGACACATATTCACATGAGGGAAAAAATTCTTTCATTGCTGGTTGTGACATTGATTTGGAACATAAGCAGGAGGAGAAAGAGATTGACATGTCCTTAATGAAGGAGGAAATTACAGTTGAGGAATTGAAAGTTCCTTCCAGTGATCTGGAgggacatcttttgattcatgagggcaaaaagccacataagtgtgaaatttgcgggaagagctttacccaggctACTGATTTGAGGAAACATATTTTGATACATGATGGAAAAAAGCCACATAAGTGCGAAATATGTGGTAAGAGCTTTACCACAGCATCTAATTTAAGGGGGCatgttttgattcatgagggcactAAGCCAcacaagtgtgaagtttgtgggaaaagttttACACATGTATCTAATCTGAGGGGACATCGTTTGATTCATGAGGGGAAGAAGCCCCACCAGTGTAacatttgtgggaagagctttacacagTCATCTTATTTGAGGaagcatattttgattcatgggggcaagaaaccacataaatgcgaaatatgtgaaaaaaaatttaccaaaGCATCTAATTTAAGGGTACATCttatgattcatgagggtaaCAAGCCAcacaagtgtgaagtttgtggtaagagctttatCAAGGAATATCATTTGAGGGCACATCTACTCATGCATGAGGATCAAAGGCCCCATAAATGTGATCTTTGTGGTAAGAGCTTCATTTATGCTTATATTCTAAGAGGACATCAgatgattcatgagggcaaaaaaccacataaatgtgaagtttgtggaaagggCTTTATGAAGTTATCTATTTTGAGCAGACATCTTTCTGTTCACAAagccaaataa
Protein Sequence: MEVKLEIKEEPLDNDTYSHEGKNSFIAGCDIDLEHKQEEKEIDMSLMKEEITVEELKVPSSDLEGHLLIHEGKKPHKCEICGKSFTQATDLRKHILIHDGKKPHKCEICGKSFTTASNLRGHVLIHEGTKPHKCEVCGKSFTHVSNLRGHRLIHEGKKPHQCNICGKSFTQSSYLRKHILIHGGKKPHKCEICEKKFTKASNLRVHLMIHEGNKPHKCEVCGKSFIKEYHLRAHLLMHEDQRPHKCDLCGKSFIYAYILRGHQMIHEGKKPHKCEVCGKGFMKLSILSRHLSVHKAK

Sequence clustering based on sequence similarity using MMseqs2