Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 1.8 1.3e+03 1.3 0.0 25 43 63 81 51 87 0.82

2 7 0.012 9.4 8.2 0.0 21 52 87 118 83 119 0.84

3 7 0.0024 1.8 10.5 0.1 23 47 117 141 113 147 0.83

4 7 0.92 7.1e+02 2.2 0.1 23 43 145 165 141 173 0.87

5 7 0.018 14 7.7 0.0 21 44 171 194 166 204 0.85

6 7 9.9 7.6e+03 -1.1 0.0 22 43 200 221 195 226 0.74

7 7 8.9 6.8e+03 -0.9 0.0 26 43 229 246 216 250 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	1.8	1.3e+03	1.3	0.0	25	43	63	81	51	87	0.82
2	7	0.012	9.4	8.2	0.0	21	52	87	118	83	119	0.84
3	7	0.0024	1.8	10.5	0.1	23	47	117	141	113	147	0.83
4	7	0.92	7.1e+02	2.2	0.1	23	43	145	165	141	173	0.87
5	7	0.018	14	7.7	0.0	21	44	171	194	166	204	0.85
6	7	9.9	7.6e+03	-1.1	0.0	22	43	200	221	195	226	0.74
7	7	8.9	6.8e+03	-0.9	0.0	26	43	229	246	216	250	0.84

Coding Sequence: ATGGAAGAATCATTACATGTTAAACTTCTTCATATTTGCAATTGTTGCGATGTAGTTTACTCTGATCTTGAAGATTCTGGTGATGATCTGAGTCACTCAGATGGTATTGAGGCAGCATCCTCTCAGAGCAGCATGGAAACAGAGGCTCTTGAAGAAGGAACTGATAAAGGAGGAAGTGCAGGAAAACGAGCTTGTGATGTGTGTGGAAGGTTTTTTACTACAGGCTATAACTTGAAAAGGCATAAGCTTACACATACTGGTGAAAAACCTTATACCTGTGACATCTGTGGCAAATCATTTACTCAAACTTTTGATCTTAAGACTCACAAACTTATGCACACAAATTCAAAGCCACATACATGTGATATTTGTGGTAATGGCTTTGCTACAAGCTCAAAGCTTAGAAGACACAACCTTATTCACACTGGTGCAAGGCCATATACCTGTGATGTATGTggaaaatgttttgcagaaaCTTCAGATGTTAAAAGGCATAAAATCACACATGCTAGTGTGAAACCACATTCTTGTGATGTATGTGGGAAATCATTCTCTCAAAGTGGCAATCTTAAAACGCACAAATTAACACATACAGATGAAAAACCACATGCATGTGATGaatgtggaaaatgttttaaaacaatctctAAGCTCAGGATACATAAAGTTACACACATGGGGTATGTCTGTCATATGTGTGGAAAGTGTTTCAGTCAAAGCTCTGATCTCAGTGAACATAAACTGACACATGGAAGTTAA
Protein Sequence: MEESLHVKLLHICNCCDVVYSDLEDSGDDLSHSDGIEAASSQSSMETEALEEGTDKGGSAGKRACDVCGRFFTTGYNLKRHKLTHTGEKPYTCDICGKSFTQTFDLKTHKLMHTNSKPHTCDICGNGFATSSKLRRHNLIHTGARPYTCDVCGKCFAETSDVKRHKITHASVKPHSCDVCGKSFSQSGNLKTHKLTHTDEKPHACDECGKCFKTISKLRIHKVTHMGYVCHMCGKCFSQSSDLSEHKLTHGS

Sequence clustering based on sequence similarity using MMseqs2