Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.027 21 7.1 0.1 23 51 21 49 10 51 0.82

2 9 0.0063 4.8 9.2 0.1 22 51 48 77 44 79 0.85

3 9 0.011 8.5 8.4 0.1 22 51 76 105 72 107 0.85

4 9 1.1 8.2e+02 2.0 0.1 22 47 104 129 101 134 0.82

5 9 0.047 36 6.4 0.0 22 48 132 158 128 162 0.84

6 9 0.17 1.3e+02 4.6 0.1 22 46 160 184 157 195 0.87

7 9 7.2 5.5e+03 -0.6 0.0 27 52 193 218 188 220 0.73

8 9 0.026 20 7.2 0.1 22 52 216 246 213 248 0.87

9 9 6.4 4.9e+03 -0.4 0.0 22 45 244 267 241 270 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.027	21	7.1	0.1	23	51	21	49	10	51	0.82
2	9	0.0063	4.8	9.2	0.1	22	51	48	77	44	79	0.85
3	9	0.011	8.5	8.4	0.1	22	51	76	105	72	107	0.85
4	9	1.1	8.2e+02	2.0	0.1	22	47	104	129	101	134	0.82
5	9	0.047	36	6.4	0.0	22	48	132	158	128	162	0.84
6	9	0.17	1.3e+02	4.6	0.1	22	46	160	184	157	195	0.87
7	9	7.2	5.5e+03	-0.6	0.0	27	52	193	218	188	220	0.73
8	9	0.026	20	7.2	0.1	22	52	216	246	213	248	0.87
9	9	6.4	4.9e+03	-0.4	0.0	22	45	244	267	241	270	0.85

Coding Sequence: ATGAAATGGCTTATATTTATTCGTAAACCTGAAAGGAATAATTTGATGCTACAGGGCAAAAAGCActataagtgtgaagtttgtgagaagagctttgcCCAAGCATCTAATTTAAGGgtacatcttttaattcatgagggtaagaagccacataagtgtgaagtttgtggaaagagctttacccaggcatcAAATTTAAGgttacatcttttgattcatgaaggtaagaaaccacataaatgtgaagtatgtgcAAAGAGCTTTACTCAGGCATCTACCTTAAGGAAACATCtcttgattcatgaaggaaagaagccaCATGAGTGTAAAGTTTGTAAGAAGAGCTTTGCCCAGGCAGCTCATTTACAAacacatattttgattcatgagggcaagaagccacataagtgtgataTTTGTAGTAAAAGTTTTACCCAAGCTTCTACCTTGAAAAATCATCtcttgattcatgaaggaaagaaacctcataaatgtgaagtttgtggaaagagttttgcACGGGCATATAATTTAAGaatacatcttttgattcatgagggcaagaagctacacaaatgtgaagtttgtggtaaaagCTTTACTTTACCATCCACATTAAGAAAACATCtcttgattcatgaaggaaagaagccacataaatgtgaattttgttataaaagctTTACCCAAGTATGTACCTTGAAGAAACATATCTTGATTCACAAAGGAAataagccacataaatgtgaacaTTGTATTAAGAGCTTTACACATGCAGCTtccttgaagaaacatcttttgattcataaaaAAAGGAGAGATATAAACTGA
Protein Sequence: MKWLIFIRKPERNNLMLQGKKHYKCEVCEKSFAQASNLRVHLLIHEGKKPHKCEVCGKSFTQASNLRLHLLIHEGKKPHKCEVCAKSFTQASTLRKHLLIHEGKKPHECKVCKKSFAQAAHLQTHILIHEGKKPHKCDICSKSFTQASTLKNHLLIHEGKKPHKCEVCGKSFARAYNLRIHLLIHEGKKLHKCEVCGKSFTLPSTLRKHLLIHEGKKPHKCEFCYKSFTQVCTLKKHILIHKGNKPHKCEHCIKSFTHAASLKKHLLIHKKRRDIN

Sequence clustering based on sequence similarity using MMseqs2