Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 1 7.7e+02 2.1 0.0 23 44 34 55 30 62 0.84

2 10 0.003 2.3 10.2 0.2 22 52 61 91 57 93 0.85

3 10 3.9 3e+03 0.2 0.0 22 50 89 117 86 120 0.80

4 10 0.047 36 6.4 0.0 20 45 115 140 113 147 0.90

5 10 0.47 3.6e+02 3.2 0.1 26 48 149 171 145 175 0.82

6 10 0.013 10 8.1 0.1 22 52 173 203 169 205 0.85

7 10 5.3 4e+03 -0.2 0.0 22 48 201 227 198 233 0.79

8 10 0.055 42 6.2 0.0 22 48 229 255 226 260 0.83

9 10 0.26 2e+02 4.0 0.0 22 45 257 280 254 287 0.85

10 10 2.4 1.9e+03 0.9 0.0 25 45 288 308 283 314 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	1	7.7e+02	2.1	0.0	23	44	34	55	30	62	0.84
2	10	0.003	2.3	10.2	0.2	22	52	61	91	57	93	0.85
3	10	3.9	3e+03	0.2	0.0	22	50	89	117	86	120	0.80
4	10	0.047	36	6.4	0.0	20	45	115	140	113	147	0.90
5	10	0.47	3.6e+02	3.2	0.1	26	48	149	171	145	175	0.82
6	10	0.013	10	8.1	0.1	22	52	173	203	169	205	0.85
7	10	5.3	4e+03	-0.2	0.0	22	48	201	227	198	233	0.79
8	10	0.055	42	6.2	0.0	22	48	229	255	226	260	0.83
9	10	0.26	2e+02	4.0	0.0	22	45	257	280	254	287	0.85
10	10	2.4	1.9e+03	0.9	0.0	25	45	288	308	283	314	0.83

Coding Sequence: atgcatgagGGCATAAAGCCCcataaatgtgaggtttgtgGGAAGGGTTTTAGTAGGTCATATCATTTAAAGGAACATAATCTGATTCATGAAGGCCACAAGCCTCATAAGTGTACagtttgtgggaaaaactttacCCGGGCATCTGAATTGAGAAAACATGTTTTGactcatgagggcaagaagccacataagtgtgaaatttgtggaaagtgcTTTACCCAGGCATCCAATGTGAGGAACCATCTACTTATTCATGaaggcaagaagccacataaatgtgaacaGTGTGGGAAATGCTTTACCCAGGCATCTGATTTGaagatacatattttaattcatcagGGCAAGAAGCCGCAtatgtgtgaagtttgtggaaagagctttaccagTGCATCTAATTTAAGagcacatcttttgattcatgggGACAAGAAACTACAAAAGTGTCAAGTTTGTGGGAAGACCTTTACCTATGCATCTAATTTGAGGAACCaccttttaattcatgagggtaagaagccacataaatgtaaaatttgtgaaaagagcTTTACTAAAACATCCAATTTGAGGgtacatcttttaattcatgaaggcAAAAAACCACATAAGTGTGTAGTTTGTGAGAAGAGGTTTACTGATGTATCTGCTatgagaaaacatattttaatacatgaagGCAAGAAACCATACAAATGTGACATTTGTGGGAACAGCTTCACCCAAGCATCAACTCTGAGGGagcatattttgattcatgaggacaAGAAGCCCCATAAATGTGATGTCTgtggaaaaacatttattaaggCTTCTAACTTAACAAGacattttttgattcatgagggcactAAGGCACAtacatgtgaagtttgtggaaagagttttatgCATGCATCTACTCTGAAGAAacaccttttgattcatgagagCAAAAAACTATGA
Protein Sequence: MHEGIKPHKCEVCGKGFSRSYHLKEHNLIHEGHKPHKCTVCGKNFTRASELRKHVLTHEGKKPHKCEICGKCFTQASNVRNHLLIHEGKKPHKCEQCGKCFTQASDLKIHILIHQGKKPHMCEVCGKSFTSASNLRAHLLIHGDKKLQKCQVCGKTFTYASNLRNHLLIHEGKKPHKCKICEKSFTKTSNLRVHLLIHEGKKPHKCVVCEKRFTDVSAMRKHILIHEGKKPYKCDICGNSFTQASTLREHILIHEDKKPHKCDVCGKTFIKASNLTRHFLIHEGTKAHTCEVCGKSFMHASTLKKHLLIHESKKL

Sequence clustering based on sequence similarity using MMseqs2