Basic Information

Gene Symbol
-
Assembly
GCA_030762175.1
Location
CM060830.1:5452370-5453611[+]

Transcription Factor Domain

TF Family
zf-GAGA
Domain
zf-GAGA domain
PFAM
PF09237
TF Group
Zinc-Coordinating Group
Description
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 11 0.37 2.8e+02 3.5 0.0 23 52 47 76 44 78 0.86
2 11 0.14 1.1e+02 4.9 0.1 26 52 106 132 99 134 0.88
3 11 0.42 3.2e+02 3.3 0.1 22 45 158 181 150 189 0.83
4 11 3.6 2.7e+03 0.4 0.1 22 45 186 209 179 217 0.82
5 11 0.39 3e+02 3.4 0.1 22 48 214 240 205 244 0.84
6 11 0.0076 5.8 8.9 0.1 22 46 242 266 238 273 0.88
7 11 0.72 5.5e+02 2.6 0.1 26 52 274 300 268 301 0.84
8 11 0.12 93 5.1 0.1 22 51 298 327 294 329 0.85
9 11 0.74 5.7e+02 2.5 0.0 22 48 326 352 323 356 0.83
10 11 0.0036 2.8 9.9 0.1 22 51 354 383 351 385 0.85
11 11 0.022 17 7.4 0.1 22 51 382 411 378 413 0.85

Sequence Information

Coding Sequence
ATGTTCACTGACCCTCCATCTTTAAAAgatcatttattaattcatgactctgaaaaaaaatataaatgtgaattctGTGAAAAAGGTTTTACTCGGGCATCAGCCTTGAAAAACCATGTTTTGATTCATGGGGGCAAGACACCAcctaagtgtgaagtttgtggaaagagttttactcATTCATCTTATTTGAGGACACATCttatgattcatgagggcaagaagccacataaatgtaaagtatgtggaaagagttttacccaTGCAAGTGCTTTGAGGGCACATCGTTTGATTCATGAAGACAAGAAGCtacataagtgtgaaatttgtggaaagagctttttCCAAGCATCATATTTGAGGCAACATCTTTTgcttcatgagggcaagaagccacataaatgtgaagtttgtgaaaagagcTTTATCCGCCCATCTTACTTGAGGGATCATcgtttgattcatgagggcaagaagccacataagtgtgaaatttgtgggaagagttttacccaAACATCTTACTTAAGGGATCATCGTTTGATTCATGAGGGAAAGAAGCCGCATAAGTGTgaattttgtgggaagagctttaaccGCTCATCTACTTTGAGGGCACATCGTTttattcatgagggcaagaagccacataagtgtgaagtttgcgGAAAGAGCTTTATCCAAGCATCTTATTTGAGGCAACATTttatgattcatgagggcaagaagccacataagtgtgaagtttgtggaaagagctttatacAAGCATATAATTTGAGGAAACATCTTATGATTCACGAGGGCAAGAAGcgacataagtgtgaagtttgtggaaagagctttatacAAGCATCTTATTTGAGGCAACATCTTATGATTCACGAGGGCAAGAAGCCGCATAAATGTCaactttgtggaaagagttttacccaAGCATCTACTTTGAgagaacatcttttgattcatgagggcaagaagccacaaaagtgtgaagtttgtggaaagagttttacccaTGCAAATACTTTGAGggcacatcttttgatgcatgaaggcaagaagccacataaatgtgaagtttgcggGAAGAGCTTTAACCAAGCATCTAATTTGAGgcatcatcttttgattcatgagggcaaaaagccacataagtgtgaaatttgtgaaaagagtTTTATCCAAGCATCTACTTTGaggcaacatcttttgattcatgagggcaaaaagccacattag
Protein Sequence
MFTDPPSLKDHLLIHDSEKKYKCEFCEKGFTRASALKNHVLIHGGKTPPKCEVCGKSFTHSSYLRTHLMIHEGKKPHKCKVCGKSFTHASALRAHRLIHEDKKLHKCEICGKSFFQASYLRQHLLLHEGKKPHKCEVCEKSFIRPSYLRDHRLIHEGKKPHKCEICGKSFTQTSYLRDHRLIHEGKKPHKCEFCGKSFNRSSTLRAHRFIHEGKKPHKCEVCGKSFIQASYLRQHFMIHEGKKPHKCEVCGKSFIQAYNLRKHLMIHEGKKRHKCEVCGKSFIQASYLRQHLMIHEGKKPHKCQLCGKSFTQASTLREHLLIHEGKKPQKCEVCGKSFTHANTLRAHLLMHEGKKPHKCEVCGKSFNQASNLRHHLLIHEGKKPHKCEICEKSFIQASTLRQHLLIHEGKKPH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00995435;
90% Identity
iTF_00995435;
80% Identity
iTF_00995435;