Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.46 3.5e+02 3.2 0.0 22 52 62 92 59 93 0.88

2 8 0.075 57 5.7 0.3 20 44 88 112 85 120 0.89

3 8 0.24 1.9e+02 4.1 0.1 27 45 123 141 117 149 0.81

4 8 0.02 15 7.6 0.1 22 51 146 175 142 177 0.85

5 8 0.017 13 7.8 0.0 22 51 174 203 171 205 0.85

6 8 0.073 56 5.8 0.1 22 51 202 231 199 233 0.85

7 8 0.16 1.2e+02 4.7 0.0 22 52 230 260 226 262 0.85

8 8 0.052 40 6.2 0.2 26 52 290 316 283 317 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.46	3.5e+02	3.2	0.0	22	52	62	92	59	93	0.88
2	8	0.075	57	5.7	0.3	20	44	88	112	85	120	0.89
3	8	0.24	1.9e+02	4.1	0.1	27	45	123	141	117	149	0.81
4	8	0.02	15	7.6	0.1	22	51	146	175	142	177	0.85
5	8	0.017	13	7.8	0.0	22	51	174	203	171	205	0.85
6	8	0.073	56	5.8	0.1	22	51	202	231	199	233	0.85
7	8	0.16	1.2e+02	4.7	0.0	22	52	230	260	226	262	0.85
8	8	0.052	40	6.2	0.2	26	52	290	316	283	317	0.85

Coding Sequence: atgaatatcaAACTAGAGATCAAGGAAGAGGAGCTAGATCCTGATATAGATTCATATGAATTTAACTCTGAATCTTTGAAAAAGAACTCATATAATGCTGCCCATGATACCATGTTGAAGATTGAGGTAAAGagctttacccagacatctaCTTTGGAgattcatcttttgattcatgagggcaagaaacctcatatatgtgaagtttgtggaaagagctttacccagaagGGACATTTGAAGGGACATTTGACTATTCATGAGagcaagaaaccacataagtgtgaagtttgtggaaaatgttttaaCCAGCCATCTAAATTGAGGAAACATTGTTTAATTCACGAGGGCAAGAAGCTTTTTATGTGTGAactttgtgggaagagctttacccattCATCTACTCTAAGAAGACATCTTTTGACTCATGAGGGTAAaaagccatataaatgtgaaatttgtgggaaaagcGTTACACATTCATCTACTTTGAGggctcatcttttgattcatgaaggcaagaaaCCCCATAAGTGTGAGGTTTGTGGTAAAAGCTTTACACAGTCATCTCATTTGAGAggacatcttttaattcatgagggcaaaaaaccacataagtgtaaagtttgtggaaagagctttacccagacatctaCTTTGAGGGCTcaccttttgattcatgagggtaagaagccccataaatgtgaagtttgtgggaaggaTTTTACCCAGTCATCTCATTTGAagggacatcttttgattcatgagggcaaaaagcctCATAAGTgcaaagtttgtggaaagagatTTACTTACACATCTCATTTGAGGGGACATAGTtttattcatgagggtaagaagcgatataaatgtgaactttgtggAAGAAGCTTTACACAGTCTTCTTCtttgaggaaacatcttttgGTACATAACAATAAGAAACCTTGTAAGCATGAAGTTGCTTAA
Protein Sequence: MNIKLEIKEEELDPDIDSYEFNSESLKKNSYNAAHDTMLKIEVKSFTQTSTLEIHLLIHEGKKPHICEVCGKSFTQKGHLKGHLTIHESKKPHKCEVCGKCFNQPSKLRKHCLIHEGKKLFMCELCGKSFTHSSTLRRHLLTHEGKKPYKCEICGKSVTHSSTLRAHLLIHEGKKPHKCEVCGKSFTQSSHLRGHLLIHEGKKPHKCKVCGKSFTQTSTLRAHLLIHEGKKPHKCEVCGKDFTQSSHLKGHLLIHEGKKPHKCKVCGKRFTYTSHLRGHSFIHEGKKRYKCELCGRSFTQSSSLRKHLLVHNNKKPCKHEVA

Sequence clustering based on sequence similarity using MMseqs2