Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 7.7 5.9e+03 -0.7 0.0 24 44 5 25 3 33 0.80

2 9 0.03 23 7.0 0.1 26 51 35 60 28 62 0.82

3 9 0.19 1.4e+02 4.5 0.1 22 50 59 87 56 90 0.84

4 9 1.7 1.3e+03 1.4 0.0 22 51 87 116 84 117 0.83

5 9 0.014 11 8.1 0.0 22 47 115 140 110 145 0.83

6 9 0.00064 0.49 12.3 0.0 22 51 143 172 140 174 0.85

7 9 0.096 74 5.4 0.1 23 48 172 197 168 201 0.84

8 9 0.026 20 7.2 0.1 22 51 199 228 195 230 0.85

9 9 1.7 1.3e+03 1.4 0.0 22 44 227 249 224 252 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	7.7	5.9e+03	-0.7	0.0	24	44	5	25	3	33	0.80
2	9	0.03	23	7.0	0.1	26	51	35	60	28	62	0.82
3	9	0.19	1.4e+02	4.5	0.1	22	50	59	87	56	90	0.84
4	9	1.7	1.3e+03	1.4	0.0	22	51	87	116	84	117	0.83
5	9	0.014	11	8.1	0.0	22	47	115	140	110	145	0.83
6	9	0.00064	0.49	12.3	0.0	22	51	143	172	140	174	0.85
7	9	0.096	74	5.4	0.1	23	48	172	197	168	201	0.84
8	9	0.026	20	7.2	0.1	22	51	199	228	195	230	0.85
9	9	1.7	1.3e+03	1.4	0.0	22	44	227	249	224	252	0.87

Coding Sequence: ATGAAGCTGCAGTCACATAAATGTGACATTTGTGGGGGGATCTTCCCTCTGGCATCTCATTTacagaaacatattttgattcatgaaaaTAAGAAttcacataaatgtaaattttgtgggAAAAACATTACCCGAGCATCTAATTTAAgaaaacatcttttaattcatgagggtaagaaaccacataaatgtgaaatttgtgggaagagctttacccaggcatGTACCTTGAAGttgcatcttttgattcacgagggtaagaagccatataaatgtgaagtttgtggaaaaaacTTTACTTGGGCAGCTCATTTAAGGGTACATCTTTcaattcatgagggcaagaaaccacataaatgtaaagtttgtggaaagagctttacccagacatctaATTTAAGAACTCactttttgattcatgagggtaagaaaccacataaatgtgaagtttgtgggaagagctttacccagtcatctaatttaagggaacatcttttgattcatgaaggaagaaagccacataagtgtgaagtttgtgggaagagctataCCCATACAACTAATTTAAGGatgcatcttttgattcatgagggtaagaaaccacataaatgtgaagtttgtggtaaatGTTTTACTCAAGCATCTACCTTGAGGGAACATCTCTTAATTCATGAgggaaagaagccacataagtgtaaagtttgtgggaaaCACTTTACCCAGACATCTACCATGAACAGGCATTTTTTGACTCATAAGTGA
Protein Sequence: MKLQSHKCDICGGIFPLASHLQKHILIHENKNSHKCKFCGKNITRASNLRKHLLIHEGKKPHKCEICGKSFTQACTLKLHLLIHEGKKPYKCEVCGKNFTWAAHLRVHLSIHEGKKPHKCKVCGKSFTQTSNLRTHFLIHEGKKPHKCEVCGKSFTQSSNLREHLLIHEGRKPHKCEVCGKSYTHTTNLRMHLLIHEGKKPHKCEVCGKCFTQASTLREHLLIHEGKKPHKCKVCGKHFTQTSTMNRHFLTHK

Sequence clustering based on sequence similarity using MMseqs2