Mvio016322.1
Basic Information
- Insect
- Metallyticus violacea
- Gene Symbol
- -
- Assembly
- GCA_030762175.1
- Location
- CM060834.1:9527656-9528858[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 11 1.1 8.3e+02 2.0 0.1 22 52 33 63 25 65 0.84 2 11 0.013 9.7 8.2 0.1 21 52 88 119 80 121 0.86 3 11 0.73 5.6e+02 2.6 0.0 22 47 117 142 114 147 0.81 4 11 0.15 1.1e+02 4.8 0.0 22 44 145 167 142 172 0.90 5 11 0.014 11 8.1 0.1 21 52 172 203 169 205 0.87 6 11 0.53 4.1e+02 3.0 0.2 22 52 229 259 226 261 0.84 7 11 2.4 1.8e+03 0.9 0.0 23 44 258 279 255 283 0.88 8 11 0.0058 4.5 9.3 0.1 21 51 284 314 281 316 0.86 9 11 5.8 4.4e+03 -0.3 0.0 23 48 314 339 311 344 0.79 10 11 0.031 24 6.9 0.0 22 52 341 371 337 372 0.87 11 11 1.7 1.3e+03 1.4 0.1 21 44 368 391 364 397 0.85
Sequence Information
- Coding Sequence
- atgcatGAGAGCAAAAAGCTGCATAAGTGTAAAGTTTGCAAGAAAGACTTTACTCAGACATCTGCCTTAAGGAAATCTCCTTTGATTAATGAGGGCAAGAAAccttataaatgtgaagtttgtgaaaagagcTTTAGCAGGGCATCTCATTTAAGgttacatcttttgattcatgagggcaagaaaccacataaatgtgaaacttgtgggaagagttttacccaAGCGTCTACCTTAAAGGGACATCGTTTGATTCATGAAGgagagaaaccacataaatgtgaagtttgtggaaaaagctTTAGTCAGGCATCTCATTTGAGGgagcatcttttgattcatgagggtaagaaaccacatacaTGTAAAGTTTGTGGAAAAAGCTTCACTGCTCTAtctacttttagaaaacatcttttgattcatgagggtaagaaaccacataaatgtgaagtttgtgggaaaagctttacacAAGCATCTAATTTAAAGGGACATCTTTTGGCTCACGAAGgagagaaaccacataaatgtgaaatttgtgggaaaagcttcGTCCAGGCATCTCATTTGAGAGGACATCTCTTGATTCATGAAGGTCAAaagcctcataaatgtgaagtttgtgggaaaagtttCACTGCGCTCTCTACTTTGAGAACACactttttgattcatgagggcaagaaaccacataaatgtgaaatttgtgggaagtgTTTTACCATGGCATCTCATTTGAGgatacatcttttgattcatgagggcaagaaaccacataagtgtgaagtttgtggaaagaattTTACCCAAGCATCTACCTTAAAGGGACATCTCTTAATTCATGAAGgagagaaaccacataaatgtgaaatttgtggaaaaagctttacccaggcatctcATTTAAGGgagcatcttttgattcatgagggtaagaaaccacataaatgtaaagtttgtgggaacAGTTTCACTGCTCTATCTACTTTCagaaaacatcttttgattcatgagggtaagaaaccatataaatgtgaagtttgtgggaagagctttacccaagcATCTAACTTAAAGGGACATCTCCGGATTCATGAAGgagagaaaccacataaatgtgaagtttgtgggaaaagcttcaCTGTGCTACCTAGTTTgagaaaacatcttttgattcatgaaggcaagaaaTTACATTAA
- Protein Sequence
- MHESKKLHKCKVCKKDFTQTSALRKSPLINEGKKPYKCEVCEKSFSRASHLRLHLLIHEGKKPHKCETCGKSFTQASTLKGHRLIHEGEKPHKCEVCGKSFSQASHLREHLLIHEGKKPHTCKVCGKSFTALSTFRKHLLIHEGKKPHKCEVCGKSFTQASNLKGHLLAHEGEKPHKCEICGKSFVQASHLRGHLLIHEGQKPHKCEVCGKSFTALSTLRTHFLIHEGKKPHKCEICGKCFTMASHLRIHLLIHEGKKPHKCEVCGKNFTQASTLKGHLLIHEGEKPHKCEICGKSFTQASHLREHLLIHEGKKPHKCKVCGNSFTALSTFRKHLLIHEGKKPYKCEVCGKSFTQASNLKGHLRIHEGEKPHKCEVCGKSFTVLPSLRKHLLIHEGKKLH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00995452;
- 90% Identity
- iTF_00995452;
- 80% Identity
- iTF_00995452;