Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.88 6.8e+02 2.3 0.1 26 52 9 35 4 36 0.84

2 11 3.1 2.3e+03 0.6 0.0 22 47 33 58 30 64 0.81

3 11 0.45 3.5e+02 3.2 0.0 22 52 61 91 57 93 0.85

4 11 2.6 2e+03 0.8 0.0 22 44 89 111 86 117 0.88

5 11 0.71 5.4e+02 2.6 0.1 26 46 121 141 112 148 0.82

6 11 0.26 2e+02 4.0 0.5 26 48 149 171 142 175 0.84

7 11 0.25 1.9e+02 4.0 0.0 22 48 173 199 169 203 0.84

8 11 0.0031 2.3 10.2 0.0 22 46 201 225 198 232 0.87

9 11 0.43 3.3e+02 3.3 0.2 26 51 233 258 228 260 0.69

10 11 0.16 1.2e+02 4.7 0.0 22 52 257 287 254 289 0.85

11 11 0.00028 0.22 13.5 0.0 22 44 285 307 282 313 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.88	6.8e+02	2.3	0.1	26	52	9	35	4	36	0.84
2	11	3.1	2.3e+03	0.6	0.0	22	47	33	58	30	64	0.81
3	11	0.45	3.5e+02	3.2	0.0	22	52	61	91	57	93	0.85
4	11	2.6	2e+03	0.8	0.0	22	44	89	111	86	117	0.88
5	11	0.71	5.4e+02	2.6	0.1	26	46	121	141	112	148	0.82
6	11	0.26	2e+02	4.0	0.5	26	48	149	171	142	175	0.84
7	11	0.25	1.9e+02	4.0	0.0	22	48	173	199	169	203	0.84
8	11	0.0031	2.3	10.2	0.0	22	46	201	225	198	232	0.87
9	11	0.43	3.3e+02	3.3	0.2	26	51	233	258	228	260	0.69
10	11	0.16	1.2e+02	4.7	0.0	22	52	257	287	254	289	0.85
11	11	0.00028	0.22	13.5	0.0	22	44	285	307	282	313	0.89

Coding Sequence: atgCATGAGTGCAAAAAGcgacataaatgtgaagtttgtggaaagagatTTGTCCAAACATTTACCTTGAAGAGACATCtcttgattcatgaaggaaataAACCATATAAGTGTGAGGTTTGTGACAAAGGTTTTACCCAGGCATCCACCTTAAAGTTGCATGTTTTGATTCATgatggtaagaaaccacataaatgtgatgtttgtgggaagagttttacctGGGCATCTAATTTaaaggaacatcttttgattcatgagggtaagaaaccacataaatgtgaagtttgtgggatgGGATTCACACAGGGATCACATTTGAAGAGTCATCTTTTTAAACATGAGAACCAGAAGACTTATAAATGTGATGTTTGTGCGAAAGAGTTTacacatgaatttaattttagaagacatcttttaattcatgagcgCAAGAAGCTGCAAAAGTGTAACATTTGTGAAAAGAGCTTTAAGCGAGCATGTACCTTAAAAAGACATCTCTTAATTCATGACGGAAAGAAGCcatataagtgtgaagtttgtgggaagagctttacagaagtgtcaaatttaaaaaaacatcttttaattcatgagggcaaaaaaccacataagtgtgaagtttgtggaaaaggATTTACCCAGGGATTTAATTTGAGAAGACATCTCttgattcatgaaggcaaaaAGATGCAaatgtgtgaagtttgtgggaagagctttatacGAGTATCTACCTTAAGGAGACATCTCTTAATTCATGAGGGAAAGAAGccttataaatgtgaagtttgtggagaTGGGTTTACAGAAGCGtctaatttaaagaaacatcttttaattcatgagggtaaaaagccatgcaagtgtgaagtttgtgggaaaggTTTTACTCAGTCATTTAATTTGAGAAGACATCTTTTAACTCATGAGGGCAAGATGCTGCTTAAGAGTGATGTTCCTTCCTGGCATATAATTTGA
Protein Sequence: MHECKKRHKCEVCGKRFVQTFTLKRHLLIHEGNKPYKCEVCDKGFTQASTLKLHVLIHDGKKPHKCDVCGKSFTWASNLKEHLLIHEGKKPHKCEVCGMGFTQGSHLKSHLFKHENQKTYKCDVCAKEFTHEFNFRRHLLIHERKKLQKCNICEKSFKRACTLKRHLLIHDGKKPYKCEVCGKSFTEVSNLKKHLLIHEGKKPHKCEVCGKGFTQGFNLRRHLLIHEGKKMQMCEVCGKSFIRVSTLRRHLLIHEGKKPYKCEVCGDGFTEASNLKKHLLIHEGKKPCKCEVCGKGFTQSFNLRRHLLTHEGKMLLKSDVPSWHII

Sequence clustering based on sequence similarity using MMseqs2