Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 4.2 3.2e+03 0.1 0.0 25 45 8 28 2 35 0.79

2 9 0.15 1.1e+02 4.8 0.0 26 45 37 56 30 64 0.85

3 9 0.056 43 6.1 0.4 22 48 61 87 57 91 0.81

4 9 0.027 21 7.1 0.1 22 52 89 119 85 121 0.85

5 9 5.5 4.2e+03 -0.2 0.0 22 44 117 139 114 143 0.81

6 9 0.0078 6 8.9 0.0 20 52 143 175 140 176 0.88

7 9 0.015 11 8.0 0.0 22 45 173 196 170 202 0.88

8 9 0.00047 0.36 12.8 0.0 23 51 202 230 198 232 0.84

9 9 0.062 48 6.0 0.0 22 45 229 252 226 258 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	4.2	3.2e+03	0.1	0.0	25	45	8	28	2	35	0.79
2	9	0.15	1.1e+02	4.8	0.0	26	45	37	56	30	64	0.85
3	9	0.056	43	6.1	0.4	22	48	61	87	57	91	0.81
4	9	0.027	21	7.1	0.1	22	52	89	119	85	121	0.85
5	9	5.5	4.2e+03	-0.2	0.0	22	44	117	139	114	143	0.81
6	9	0.0078	6	8.9	0.0	20	52	143	175	140	176	0.88
7	9	0.015	11	8.0	0.0	22	45	173	196	170	202	0.88
8	9	0.00047	0.36	12.8	0.0	23	51	202	230	198	232	0.84
9	9	0.062	48	6.0	0.0	22	45	229	252	226	258	0.88

Coding Sequence: ATGCATGAGAGCAAGAGGCGATATAAGTGCGATGTTTGTGAAAAATCATTTACCAAAAAATCTCATTtgaggactcatcttttgattcatgagggcaagaagacccataaatgtgaagtttgtggaaagaactttaaCCAGGCATCTAATATGAgaactcatcttttgattcacgaggGCGAGAAACGACACagatgtgaagtttgtggaaagagctttatacAGGCATGTAATCTGAGgtcacatcttttaattcatgagggcaagaaaccacataaatgtgaagtttgtggaaagagcttcaCACGCACTTCTAGTTTAAGGAGGCATCTTTtcattcatgagggtaagaaaccacataaatgtgaagtttgtgggaaaggTTTTATTGAAGCATCTCATTTGAGAATTCATCTTTTTATACACGAGAGCCAAAAGCCACAtaattgtgaagtttgtgggaaaggATTTGCTCAGGCCTCAGGTTTgagaaaacatcttttgattcatgagggcaataAGCCCTATAAATGTGAGgtttgtggaaagaactttagtcagtcatataatttaaagactcatctcttgattcatgagggtaaggaACCATacaagtgtgaaatttgtggaaagaactttacCCAGTCATCTAATTTAAGAactcatcttttaattcatgagggtaagaagccatataaatgtgaaatttgtgggaagagatTTACCCAGTCATCTAAATTAAAagctcatcttttgattcatgagggtaaaaacCACATAAAGTGA
Protein Sequence: MHESKRRYKCDVCEKSFTKKSHLRTHLLIHEGKKTHKCEVCGKNFNQASNMRTHLLIHEGEKRHRCEVCGKSFIQACNLRSHLLIHEGKKPHKCEVCGKSFTRTSSLRRHLFIHEGKKPHKCEVCGKGFIEASHLRIHLFIHESQKPHNCEVCGKGFAQASGLRKHLLIHEGNKPYKCEVCGKNFSQSYNLKTHLLIHEGKEPYKCEICGKNFTQSSNLRTHLLIHEGKKPYKCEICGKRFTQSSKLKAHLLIHEGKNHIK

Sequence clustering based on sequence similarity using MMseqs2