Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.014 11 8.0 0.0 20 52 24 56 20 57 0.83

2 9 0.25 1.9e+02 4.0 0.1 22 47 54 79 51 85 0.83

3 9 1.4 1.1e+03 1.7 0.0 23 44 83 104 80 110 0.87

4 9 0.0014 1.1 11.3 0.1 22 52 138 168 134 170 0.87

5 9 0.34 2.6e+02 3.6 0.2 20 50 164 194 162 197 0.84

6 9 0.00025 0.19 13.7 0.1 22 48 194 220 190 226 0.84

7 9 1.9 1.4e+03 1.2 0.0 20 45 220 245 217 252 0.75

8 9 0.0044 3.4 9.7 0.0 22 48 250 276 247 280 0.84

9 9 0.23 1.8e+02 4.2 0.0 22 45 278 301 274 303 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.014	11	8.0	0.0	20	52	24	56	20	57	0.83
2	9	0.25	1.9e+02	4.0	0.1	22	47	54	79	51	85	0.83
3	9	1.4	1.1e+03	1.7	0.0	23	44	83	104	80	110	0.87
4	9	0.0014	1.1	11.3	0.1	22	52	138	168	134	170	0.87
5	9	0.34	2.6e+02	3.6	0.2	20	50	164	194	162	197	0.84
6	9	0.00025	0.19	13.7	0.1	22	48	194	220	190	226	0.84
7	9	1.9	1.4e+03	1.2	0.0	20	45	220	245	217	252	0.75
8	9	0.0044	3.4	9.7	0.0	22	48	250	276	247	280	0.84
9	9	0.23	1.8e+02	4.2	0.0	22	45	278	301	274	303	0.90

Coding Sequence: ATGGGGGACATTTCTAACTATTTGGACAGTTCATCCACCACTTCTGTCCAATTTACAGTGGAAAAAAAAGACAGCAAAAAATCTCATAAGTGTGAAGtatgtgagaagagctttacccaggcatctaacttaaagaaacatctttggattcatgagggcaagaagccataTACATGTGAAGTTTGTGCAAAGAACTTCGCCTATAAATCacatttaagggaacatcttttgattcatggtggcaagaaaccatataaatgcgAAATTTGTAGAAAGAGCTTTACTTTGTCATCtactttgaagaaacattttttgattcatgaggacAAGGAGttacataagtgtgaagtttgtggaaagtgCTTTACCCGATTATGCTATTTtaggacacatcttttgattcacaagGGAAAGAAGCCCCATGAGTGTGAGATATGTGGAAAAAACTTTACCCAGGCTTCCAATTTAAGagaacatcttttaattcatcagagaaagaagccacataaatgtgaagtttgtgcgAAGACCTTCACCTATAAATCacatttaagggaacatcttttgattcatgaggacaAAAAACCatataagtgtgaaatttgtagGAAAAGCTTTAGGCAGACATCTAATTTGAAGAAGCATCTTGTGACTCATCAGGACAAAAAGCCACATAAGtgcaaaatttgtggaaagagctttaccagATTATTCTATTTcaggacacatcttttgattcatgagggaaaGAAGCCCCATGAGTGTGAGATATGTGGAAAAAACTTTACCCAGGCATTCAATTTAAGagaacatcttttaattcatgagggtaagaagccgcataattgtgaaatttgtggaaaaagctttacccaaatatctcatttaaagaaacatctttcaACTCATTAG
Protein Sequence: MGDISNYLDSSSTTSVQFTVEKKDSKKSHKCEVCEKSFTQASNLKKHLWIHEGKKPYTCEVCAKNFAYKSHLREHLLIHGGKKPYKCEICRKSFTLSSTLKKHFLIHEDKELHKCEVCGKCFTRLCYFRTHLLIHKGKKPHECEICGKNFTQASNLREHLLIHQRKKPHKCEVCAKTFTYKSHLREHLLIHEDKKPYKCEICRKSFRQTSNLKKHLVTHQDKKPHKCKICGKSFTRLFYFRTHLLIHEGKKPHECEICGKNFTQAFNLREHLLIHEGKKPHNCEICGKSFTQISHLKKHLSTH

Sequence clustering based on sequence similarity using MMseqs2