Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 1.2 9.2e+02 1.9 0.0 27 46 76 94 72 101 0.82

2 9 0.0019 1.5 10.8 0.1 22 51 99 128 95 130 0.84

3 9 0.0032 2.5 10.1 0.0 22 48 127 153 124 157 0.84

4 9 0.014 11 8.0 0.2 22 44 155 177 152 185 0.86

5 9 0.015 11 8.0 0.1 26 51 187 212 179 214 0.83

6 9 0.047 36 6.4 0.1 22 50 211 239 207 242 0.83

7 9 0.026 20 7.2 0.1 22 48 239 265 236 270 0.84

8 9 0.0012 0.93 11.5 0.0 22 52 267 297 264 299 0.86

9 9 0.4 3e+02 3.4 0.0 23 46 296 319 292 323 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	1.2	9.2e+02	1.9	0.0	27	46	76	94	72	101	0.82
2	9	0.0019	1.5	10.8	0.1	22	51	99	128	95	130	0.84
3	9	0.0032	2.5	10.1	0.0	22	48	127	153	124	157	0.84
4	9	0.014	11	8.0	0.2	22	44	155	177	152	185	0.86
5	9	0.015	11	8.0	0.1	26	51	187	212	179	214	0.83
6	9	0.047	36	6.4	0.1	22	50	211	239	207	242	0.83
7	9	0.026	20	7.2	0.1	22	48	239	265	236	270	0.84
8	9	0.0012	0.93	11.5	0.0	22	52	267	297	264	299	0.86
9	9	0.4	3e+02	3.4	0.0	23	46	296	319	292	323	0.87

Coding Sequence: ATGGATGTGAAGGTAGAGATTAAGGAAGAATTACTGGACAATGATGCAGACTCACTGGATTTGAAACCAGAAATTAAAGAGGAAAATTCTTGCAATGCTGCTCATTGCATtatggaggaaaaagaaaagGAGCAGGAGCTTGACATAGCTGTAATGAAGGATGAAATCACAGTTGAGGAATTAAATTATTCATGCATTAATCCAGGGATCAAGAAGTTAcctaagtgtgaagtttgtgggaagagctttaccaagACATCTAATTTGAGGGTACATCTTCTTAATCACGaaggcaagaagccacataagtgtgcaATATGTGGAGTAGGCTTCATCCAGGCATCTAAATTGAGGcgacatcttttaattcatgagggcaagaagccccataaatgtgaagtttgtgggaagagctttacccaggcatctaATTTGAGAcagcatcttttgattcatgagggcaagaagcctcATAAGTGTGTAATTTGTGAATTGAGCTTTATCCAGGCATCTTATTTGAGGCGACATCTTTTAAGTCATGAGGGCAAGAAGACATacaagtgtgaagtttgtgacAAGAGCTTTACCCAAGCAAGAACTTTGAGGCAACATCTTCTAATTCACGAGGGCAAGAAgccccataagtgtgaagtttgtggcttGAGCTTTACATATGCCTTTAATTTAAGgagacatattttgattcatgatgggaaaaagccacataagtgtgaagtttgtgggaagagctttactcaatCATCTTGTTTGAGGAAACATGTTCttattcatgagggcaagaagccctataaatgtgaaatttgtgggaagagctttactcaggcaTCTAATTTAAGGCAACATCTTATAATTCATGAAGGCaagaagccatataaatgtgaagtttgtgggttGAGCTTTACATGGGCATCTTATTTAAGGCGACATCTTTCAATTCATGAGGGCAAGTCACATAAGTGTGAAGATTGTGGATTGAGCTTTATTCAAGCATCTAAATTGAGGCAACACCTTTTAATTCATGAGGACAAAATGGATTAA
Protein Sequence: MDVKVEIKEELLDNDADSLDLKPEIKEENSCNAAHCIMEEKEKEQELDIAVMKDEITVEELNYSCINPGIKKLPKCEVCGKSFTKTSNLRVHLLNHEGKKPHKCAICGVGFIQASKLRRHLLIHEGKKPHKCEVCGKSFTQASNLRQHLLIHEGKKPHKCVICELSFIQASYLRRHLLSHEGKKTYKCEVCDKSFTQARTLRQHLLIHEGKKPHKCEVCGLSFTYAFNLRRHILIHDGKKPHKCEVCGKSFTQSSCLRKHVLIHEGKKPYKCEICGKSFTQASNLRQHLIIHEGKKPYKCEVCGLSFTWASYLRRHLSIHEGKSHKCEDCGLSFIQASKLRQHLLIHEDKMD

Sequence clustering based on sequence similarity using MMseqs2