Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 11 0.85 6.5e+02 2.4 0.7 22 44 6 28 3 36 0.86

2 11 0.035 27 6.8 0.1 26 52 38 64 28 65 0.85

3 11 0.00077 0.59 12.1 0.1 22 52 62 92 59 93 0.87

4 11 0.0032 2.5 10.1 0.1 22 46 90 114 87 122 0.88

5 11 3.2 2.4e+03 0.5 0.1 26 45 122 141 115 147 0.84

6 11 1 7.9e+02 2.1 0.0 23 51 147 175 143 177 0.83

7 11 0.0064 4.9 9.1 0.0 22 52 174 204 171 206 0.84

8 11 0.0025 1.9 10.4 0.1 22 52 202 232 198 233 0.85

9 11 0.012 8.8 8.3 0.0 22 52 230 260 227 261 0.86

10 11 0.097 74 5.4 0.0 22 44 258 280 255 288 0.84

11 11 0.0096 7.4 8.6 0.2 22 44 286 308 280 311 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	11	0.85	6.5e+02	2.4	0.7	22	44	6	28	3	36	0.86
2	11	0.035	27	6.8	0.1	26	52	38	64	28	65	0.85
3	11	0.00077	0.59	12.1	0.1	22	52	62	92	59	93	0.87
4	11	0.0032	2.5	10.1	0.1	22	46	90	114	87	122	0.88
5	11	3.2	2.4e+03	0.5	0.1	26	45	122	141	115	147	0.84
6	11	1	7.9e+02	2.1	0.0	23	51	147	175	143	177	0.83
7	11	0.0064	4.9	9.1	0.0	22	52	174	204	171	206	0.84
8	11	0.0025	1.9	10.4	0.1	22	52	202	232	198	233	0.85
9	11	0.012	8.8	8.3	0.0	22	52	230	260	227	261	0.86
10	11	0.097	74	5.4	0.0	22	44	258	280	255	288	0.84
11	11	0.0096	7.4	8.6	0.2	22	44	286	308	280	311	0.89

Coding Sequence: atgattcatgagggcaacaagccacataagtgtgaagtttgtgctAAGAGCTTTATCCAAGCATGTCATTTGAGGCAACATcgtttgattcatgagggcaagaagtcacataaatgtgaagtttgtggaaagagctttatccaAGTATATAATTTGAGGAAACATCttatgattcatgagggcaagaagccgcataaatgtgaagtttgtggaaagagctttatccaATCATACAATTTGAGGCAACATCttatgattcatgagggcaaaaagccacataagtgtgaagtttgtggaaagaactttacACAAGCACATAATTTAAGGCAACATCTTATGATTCATGATGGCAAGAAGACACAtatgtgtgaagtttgtggaaaaagctTTCTTCAAGCATCTTATTTGAGacaacatattttgattcatgatgTCAAGCAgacacataaatgtgaagtttgtggaaagaacttttttcaagcatcttatttgaaaaaacatcttttaattcatgagggcaaaaagccacataaatgtaaagtttgtggaaagagctttatccaATCATCTAATTTGAAGAAAcacattttgattcatgagggcaagaagccacatatgtgtgaagtttgtggaaagagctttattcAAGCATCTAAtttgaggaaacatcttttgattcattcTGGCAACAAACCAcacaagtgtgaagtttgtggaaatagttttattcaagcatataatttgaagaaacatcttttgattcatgagggcaacaAGCCATATAAATGCgaagtttgtggaaaaagctTTCTCCAAGCATCTAATATGAGGAAACATCGTTTGATTCATGAGGACAAGAAGCCACAtatgtgtgaagtttgtgggaagagctttattcAGGCATGTAAtttgaggaaacatcttttgattcattag
Protein Sequence: MIHEGNKPHKCEVCAKSFIQACHLRQHRLIHEGKKSHKCEVCGKSFIQVYNLRKHLMIHEGKKPHKCEVCGKSFIQSYNLRQHLMIHEGKKPHKCEVCGKNFTQAHNLRQHLMIHDGKKTHMCEVCGKSFLQASYLRQHILIHDVKQTHKCEVCGKNFFQASYLKKHLLIHEGKKPHKCKVCGKSFIQSSNLKKHILIHEGKKPHMCEVCGKSFIQASNLRKHLLIHSGNKPHKCEVCGNSFIQAYNLKKHLLIHEGNKPYKCEVCGKSFLQASNMRKHRLIHEDKKPHMCEVCGKSFIQACNLRKHLLIH

Sequence clustering based on sequence similarity using MMseqs2