Mvio025081.1
Basic Information
- Insect
- Metallyticus violacea
- Gene Symbol
- -
- Assembly
- GCA_030762175.1
- Location
- CM060837.1:12087053-12088264[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 13 0.073 56 5.8 0.2 26 52 15 41 8 46 0.83 2 13 0.06 46 6.0 0.1 22 52 67 97 63 98 0.85 3 13 1.4 1.1e+03 1.7 0.0 22 45 95 118 91 123 0.87 4 13 0.0094 7.2 8.6 0.3 23 52 124 153 119 154 0.89 5 13 0.094 72 5.4 0.1 22 51 151 180 148 182 0.85 6 13 0.055 42 6.2 0.1 22 51 179 208 176 210 0.84 7 13 0.0026 2 10.4 0.1 22 44 207 229 204 237 0.86 8 13 0.00056 0.43 12.5 0.1 22 46 235 259 231 265 0.85 9 13 0.11 82 5.2 0.1 21 51 262 292 259 294 0.83 10 13 0.27 2e+02 4.0 0.0 22 47 291 316 288 321 0.83 11 13 0.016 12 7.9 0.2 22 45 319 342 316 350 0.85 12 13 0.00059 0.45 12.5 0.1 22 47 347 372 343 378 0.88 13 13 0.033 26 6.8 0.3 26 45 379 398 372 401 0.87
Sequence Information
- Coding Sequence
- atgataaatgaatgcgGCTTAAAAAGCCATAAAAAGACACATAactgtgaagtttgtgagaagagttTTACTAATTCATAtactttaaggagacatcttttgattcatgaaggtaggaagccacataaatgtgaagtatgtgaTAAGAGCTTTGCCTGGGCATCTAATTTATCGGAACACTTTTTGATTCACGAGGGtaaaaagccacataaatgtgaagtttgtgggaagagctttatccagGCATATCGTTTAAAGaggcatcttttgattcataagggcaagaaaccacataattgTGAGGTTTGTAATAAAAGCTTTACCAAGACATCTTATTTAAGGGGACATCTTCTAATGCATGAGGGTAGggagccacataaatgtgaagtttgtaaaaagagctttacccaggcaCATTATTTAAAGAGACATCTTTCGATTCACAGAGGTAataagccacataaatgtgaagtttgtgagaagagcttcaCCCAGGCATCTAGTTTAAGGCTACATCTCTTGATTcacgagggtaagaagccacataaatgtgaagtttgtaatAAGTGTTTTGCCTGGGCATctaatttaagggaacatcttttgattcatgagggtaagaagccacataaatgtgaagtttgtgggaagagctttacccagtcaactcatttaaggagacatctttttagtcatgagggtaagaagccacataaatgtgaaatttgtgataagaacTTTACCCAATCAGATagtttaaggagacatcttttgattcacaagagtaagaagtcacataaatgtgaaatttgtgagaagagctttacccaggcatcAAGTTTAAGgttacatcttttgattcatgagggtaagaagccacataattgtgaagtttgtaataaaagttttgcCTGGGCTTCTAATTTAAgggaacatattttgattcatgagggtaagaagccacataaatgtgaagtttgtggaaggAGCTTTACCCAGGCAACgcatttaaggagacatctttttagtcatgagggtaagaagccacataaatgtgaagtttgcgaGAAGACCTTTACCCAATCAGAtactttaaggagacatcttttgcttcatgagggtaagaagtcGCATAAATGTGAACTATGTGAGAAGATCTTTACCCAGGCACATTATTTAAGGAGGCATCTGTTAATTCACAAAGGTATgtaa
- Protein Sequence
- MINECGLKSHKKTHNCEVCEKSFTNSYTLRRHLLIHEGRKPHKCEVCDKSFAWASNLSEHFLIHEGKKPHKCEVCGKSFIQAYRLKRHLLIHKGKKPHNCEVCNKSFTKTSYLRGHLLMHEGREPHKCEVCKKSFTQAHYLKRHLSIHRGNKPHKCEVCEKSFTQASSLRLHLLIHEGKKPHKCEVCNKCFAWASNLREHLLIHEGKKPHKCEVCGKSFTQSTHLRRHLFSHEGKKPHKCEICDKNFTQSDSLRRHLLIHKSKKSHKCEICEKSFTQASSLRLHLLIHEGKKPHNCEVCNKSFAWASNLREHILIHEGKKPHKCEVCGRSFTQATHLRRHLFSHEGKKPHKCEVCEKTFTQSDTLRRHLLLHEGKKSHKCELCEKIFTQAHYLRRHLLIHKGM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00995469;
- 90% Identity
- iTF_00995469;
- 80% Identity
- iTF_00995469;