Basic Information

Gene Symbol
-
Assembly
GCA_949987695.1
Location
OX465290.1:10115634-10116284[+]

Transcription Factor Domain

TF Family
Fork_head
Domain
Fork_head domain
PFAM
PF00250
TF Group
Helix-turn-helix
Description
The fork head domain is a conserved DNA-binding domain (also known as a winged helix) of about 100 amino-acid residues. Drosophila melanogaster fork head protein is a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [1]. Instead, it contains a distinct type of DNA-binding region, containing around 100 amino acids, which has since been identified in a number of transcription factors (including D. melanogaster FD1-5, mammalian HNF-3, human HTLF, Saccharomyces cerevisiae HCM1, etc.). This is referred to as the fork head domain but is also known as a 'winged helix' [1, 2, 3]. The fork head domain binds B-DNA as a monomer [2], but shows no similarity to previously identified DNA-binding motifs. Although the domain is found in several different transcription factors, a common function is their involvement in early developmental decisions of cell fates during embryogenesis [3].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 2 0.85 2.1e+03 0.5 0.0 47 65 6 24 2 34 0.84
2 2 1.3e-27 3.3e-24 86.4 0.4 4 86 78 159 75 161 0.96

Sequence Information

Coding Sequence
ATGGCTGCATTCAAGCACAAGTTTTCAATACGCTCATTATTGGCTGATACcgatgtttttaataaatttagcatACAAGCTATCTTTGCTGAAAAGACTTTGGTGCCAAAAAATGCGAAGCATTCTAACTTTGAAGCCGACTTTTGCCGAGGTTTGCATAACTCTGCATTAAATTCTGCTTACGGCGTCCAAGTCTACAAAGCGTTGCCAATTAAATAtgtcaaatatgaaaaactaacCTACAGTTCAGCAATTTTAATGGCTATACGACGTAGTCCCGGAAATCGGCTACTATTAAGGGGCATCTACGACTGGATTGAAACAAATTGTCCATACATACCCAAAAATAATGCCAAATGGCGTGATACAGTGCGTCATAATTTAAGTCACAATGAAATATTCGTACAAGTCCCACGAGCGAAGAATGAATCAAGCCGTGGCAAGTATTGGACCATAAATGAAACTGCTGAGAATATGTACGTACTCGATTGTTCGGGAAAACTACGCCAAAAAAGTCAAATAATGAGACACAAAAGGATTTTATATCAACCGTATCAATTTGGGCAGCACAAAGATGGATATAACTGTGCTATAGCGAGATTTACAGAATGTCAGTTTTATTCGGAACAACTGGCAGTTCGAAGTGGATGa
Protein Sequence
MAAFKHKFSIRSLLADTDVFNKFSIQAIFAEKTLVPKNAKHSNFEADFCRGLHNSALNSAYGVQVYKALPIKYVKYEKLTYSSAILMAIRRSPGNRLLLRGIYDWIETNCPYIPKNNAKWRDTVRHNLSHNEIFVQVPRAKNESSRGKYWTINETAENMYVLDCSGKLRQKSQIMRHKRILYQPYQFGQHKDGYNCAIARFTECQFYSEQLAVRSG

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
-
90% Identity
-
80% Identity
-