Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.006 70 5.3 0.0 21 44 6 29 3 34 0.88

2 8 0.0012 15 7.5 0.2 21 45 34 58 26 65 0.73

3 8 0.0033 39 6.1 0.1 21 44 62 85 58 89 0.80

4 8 0.00031 3.7 9.4 0.3 21 45 90 114 86 121 0.83

5 8 0.00019 2.2 10.1 0.0 21 44 118 141 113 145 0.85

6 8 0.002 23 6.8 0.1 21 45 146 170 142 177 0.83

7 8 0.015 1.8e+02 4.0 0.1 21 44 174 197 170 205 0.79

8 8 0.1 1.2e+03 1.4 0.1 21 37 202 219 199 229 0.77

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.006	70	5.3	0.0	21	44	6	29	3	34	0.88
2	8	0.0012	15	7.5	0.2	21	45	34	58	26	65	0.73
3	8	0.0033	39	6.1	0.1	21	44	62	85	58	89	0.80
4	8	0.00031	3.7	9.4	0.3	21	45	90	114	86	121	0.83
5	8	0.00019	2.2	10.1	0.0	21	44	118	141	113	145	0.85
6	8	0.002	23	6.8	0.1	21	45	146	170	142	177	0.83
7	8	0.015	1.8e+02	4.0	0.1	21	44	174	197	170	205	0.79
8	8	0.1	1.2e+03	1.4	0.1	21	37	202	219	199	229	0.77

Coding Sequence: ATGCTACAACATAAAGAAGAGAAGCCCTTTAAGTGCACATTGTGTGCTTTTGCCACGTCAACATCGGCCAATCTTAAACAACATTCGCGACACCATACTGGGGATAAGCCCTATAAGTGCACGATATGCAACTATGCTGCAGTAGTATCAGGCAATCTTAAACAACATATACGTCAACATACAGGGGAGAAGCCCTATAAGTGCGCGCTATGTGACTATGCTACAGTGGTATCGTCCAATCTTAAACAACATATGCGTCAACACACGGGGGAAAAGCCCTATACGTGCACCATGTGTGTTTATGCCGCTGCAACATCATCCAGTCTTCGACAACATATGCGACAACATAGCGGGGAAAAACCGTTCAAGTGCACAGTGTGTGATTTTGCTACTGTGGAATCAAGTAATCTTAAAAGACATATGCGACAACATACAGGGGAGAAGCCCTATAAGTGTACAGTGTGTGAGTATGCTGCTTCGACATCGTCCAATCTTAAAGAACATATGCGACAACATACAGGCGAGAAGCCCTATATGTGTACGATGTGCGGTTATGCTGCTTCGATATCGTCCACTCTCAACCGACATATGCTACAACACACAGGGGAAAAGCCCTATAAGTGCTCGATGTGTGACTATGCTGCTTCACGATTATCATATCTTAAATTACACATGCGACAACATCCAGGACAAAAGCAAATTAGTGCAGATTAA
Protein Sequence: MLQHKEEKPFKCTLCAFATSTSANLKQHSRHHTGDKPYKCTICNYAAVVSGNLKQHIRQHTGEKPYKCALCDYATVVSSNLKQHMRQHTGEKPYTCTMCVYAAATSSSLRQHMRQHSGEKPFKCTVCDFATVESSNLKRHMRQHTGEKPYKCTVCEYAASTSSNLKEHMRQHTGEKPYMCTMCGYAASISSTLNRHMLQHTGEKPYKCSMCDYAASRLSYLKLHMRQHPGQKQISAD

Sequence clustering based on sequence similarity using MMseqs2