Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 7.7e-05 0.087 15.2 0.1 71 109 1 39 1 40 0.97

2 3 9.5e-29 1.1e-25 92.2 1.0 1 109 131 237 131 238 0.92

3 3 1.9 2.2e+03 1.1 0.1 22 75 259 311 241 313 0.75

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	7.7e-05	0.087	15.2	0.1	71	109	1	39	1	40	0.97
2	3	9.5e-29	1.1e-25	92.2	1.0	1	109	131	237	131	238	0.92
3	3	1.9	2.2e+03	1.1	0.1	22	75	259	311	241	313	0.75

Coding Sequence: ATGTATACAGGTAAAGCCATTTATACCGAGAAACTTGTGTACGAACTTTTCGAAGCTGCCATGGAATACTCAGTACGCGGTCTTCGTTCGATTTGCTCAAAATTCTTATTACAGAATTTGAATCTCGGAAACGTTATTCGCACTCTTTTGTCATGCAGTGGATACTTCTGGTACgatcaaaaatggttaaatgaACTTATTTTGAAGTGCATGCGCTTAATTGATGAACACTTAGATGAGGTTGTTAGATTGGATCTTTGTAAAGAGTTACTTGAAAAAAACCCAGAAATACTTACAGAGGTTGTGGTACATCTGTCTTCTTCGACTTCCATGATAGGAGCTTGTGTTGAAGAGGAAAGTTCCGCCTGCAcactaatttataaaaaaacgtttgaaagatTCGCAAACAATTCAGATTACAGCGACGTAGAAATTCATGTGAACGACTCGAAATATGCGGCGCATAAGGTAATTTTAGCAGCAAAAAGTGCTGTCTTTGATAGAATGTTTTCACACAATATGAAGGAGACAATATCCGGTGTCGTGACAATAGAAGACATAAGGCCTCAAGTGTTTGAGAAACTTCTTGGATTCATGTATACTAACGAAATTGAACATGAGGATGATCTCATACAGGAGATTCTGATTGCAGCTGATAAATACGAAATCGTCGATTTAAAGTTGATTTGTGCAAAGATTTTGGAGGAAAAACTGACTGGCGACAATGTTATAACAACATTGATTTTTGCCGTTGACCACAATGCAGAACGACtaaagaaaaagtgtttaagATTTATTGTTCATGCAGATAGTCCCTTTTGGAATGACAgttcaaatcatttcaatatcccaaaatcaatattgaatacaaatttggCAGAATCGCATCCATATTTACTTTATGACATGTTGAAAGTAATTCATCAAAATAGGTTCTCTTAA
Protein Sequence: MYTGKAIYTEKLVYELFEAAMEYSVRGLRSICSKFLLQNLNLGNVIRTLLSCSGYFWYDQKWLNELILKCMRLIDEHLDEVVRLDLCKELLEKNPEILTEVVVHLSSSTSMIGACVEEESSACTLIYKKTFERFANNSDYSDVEIHVNDSKYAAHKVILAAKSAVFDRMFSHNMKETISGVVTIEDIRPQVFEKLLGFMYTNEIEHEDDLIQEILIAADKYEIVDLKLICAKILEEKLTGDNVITTLIFAVDHNAERLKKKCLRFIVHADSPFWNDSSNHFNIPKSILNTNLAESHPYLLYDMLKVIHQNRFS

Sequence clustering based on sequence similarity using MMseqs2