Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 1.9 1.9e+04 -2.2 0.0 21 37 12 29 10 32 0.73

2 5 0.0012 12 8.0 0.3 18 48 81 110 69 114 0.77

3 5 2.8e-05 0.28 13.2 0.0 21 52 111 142 107 143 0.88

4 5 0.0056 56 5.9 0.0 21 51 139 169 137 170 0.87

5 5 0.00022 2.2 10.3 0.1 21 47 167 193 165 198 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	1.9	1.9e+04	-2.2	0.0	21	37	12	29	10	32	0.73
2	5	0.0012	12	8.0	0.3	18	48	81	110	69	114	0.77
3	5	2.8e-05	0.28	13.2	0.0	21	52	111	142	107	143	0.88
4	5	0.0056	56	5.9	0.0	21	51	139	169	137	170	0.87
5	5	0.00022	2.2	10.3	0.1	21	47	167	193	165	198	0.89

Coding Sequence: ATGACTAATTGTGAAATTGTTATCGTTGCGACAAGTGATGAACCAGCAACTGATATACAAATCCCATTTAACGTGATAACTTCGTCGGCAACAGTTTCAGCGTCTGGTGTCACGACTACGACTCATCATCTCGCACCACTGCAACAAAACGCGGAACAGCAGGTTCTATTGCAGTCCGAAGCTCTTCAGCAACAAGTGCAAGCAGGTATAGTACCGCCGAACTTGGAGCGATATCCTGCCAATGGTCAAGAGAAGCCATTCCAATGCAATATTTGTGAGCGAAGGTTTCGACAGCTCAGCACACTAACAAACCACGTCAAAATCCACACCGGTGAGAAACCCTATAAATGCACGATATGCGACAAAACATTTCGACAATCGAGCACCCTGACGAATCACATGAAAATCCATACCGGCGAAAAACCGTTCATTTGCTCATTTTGTCCGAAGCAATTTCGTCAACTGAGCACGCTGACAAATCACCTGAAAATCCATACCGGAGAAAAACCATTCGAATGTGCCGTCTGCAAAAAACAATTCCGCCAATCAAGTACGCTCAACAATCACATAAAGATTCACGTCATGGACAAGGTGTACATACCCGTAAAGATCAAAACAGAGGAAGAAGAAGGATGA
Protein Sequence: MTNCEIVIVATSDEPATDIQIPFNVITSSATVSASGVTTTTHHLAPLQQNAEQQVLLQSEALQQQVQAGIVPPNLERYPANGQEKPFQCNICERRFRQLSTLTNHVKIHTGEKPYKCTICDKTFRQSSTLTNHMKIHTGEKPFICSFCPKQFRQLSTLTNHLKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVYIPVKIKTEEEEG

Sequence clustering based on sequence similarity using MMseqs2