Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.006 97 5.3 0.1 18 47 39 68 33 73 0.84

2 5 0.0012 20 7.5 0.2 23 45 72 94 68 97 0.90

3 5 6.2e-05 1 11.7 0.3 20 48 97 124 93 129 0.85

4 5 0.013 2.1e+02 4.3 0.2 21 44 126 149 124 159 0.88

5 5 0.00047 7.6 8.8 0.1 23 45 156 178 151 182 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.006	97	5.3	0.1	18	47	39	68	33	73	0.84
2	5	0.0012	20	7.5	0.2	23	45	72	94	68	97	0.90
3	5	6.2e-05	1	11.7	0.3	20	48	97	124	93	129	0.85
4	5	0.013	2.1e+02	4.3	0.2	21	44	126	149	124	159	0.88
5	5	0.00047	7.6	8.8	0.1	23	45	156	178	151	182	0.90

Coding Sequence: ATGGCATCAGAACTATTGGACGATTTATGCAACCAAATTTATGCTTGTCGCCGTTGTAAACAGACATTTAACTCAAAAAAGGATCAACTAATGCATAAAAAACAGAAACATGATCGAAATCTTGCTGAAAATAGATATGCTTGCAATTTGTGCCAAAAAACCTTTTCTAATCATGGCAATTTAGAGCGTCATATGAAAGTTCACAATGATGTCCGGCCTCACACCTGTAAAGAATGCAATAAATCTTTTGCACAAGCCGTGAATTTACAACGCCATTATTCTGTACATAACGGCGAACGACCTTATGAATGCCAGCTATGTGATAGAGCCTTTACGCAGCAAGGGAATTTGCGACGTCATGAACTCATTCATACAGGCGAGAAACCGTTTCAGTGTGAACGATGTAATCGATCGTTTTCACAGAGAATTAATCTTAAGAAACACATGATGGCTCATGAAGGATTTCGACCGTATGTGTGCAGTGTGTGTCAGAAGTCTTTTATTCAATCTCAAAACTACAAGAAACACCTCAACAAACATCAAAAAGAGACAGTTCGACAGGAACAGGCTGACGCTGCATTGGCAAAGGTTAAGATTGAACCAACGATGTGA
Protein Sequence: MASELLDDLCNQIYACRRCKQTFNSKKDQLMHKKQKHDRNLAENRYACNLCQKTFSNHGNLERHMKVHNDVRPHTCKECNKSFAQAVNLQRHYSVHNGERPYECQLCDRAFTQQGNLRRHELIHTGEKPFQCERCNRSFSQRINLKKHMMAHEGFRPYVCSVCQKSFIQSQNYKKHLNKHQKETVRQEQADAALAKVKIEPTM

Sequence clustering based on sequence similarity using MMseqs2