Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 3 1.2e+04 -4.1 3.5 9 30 21 42 17 55 0.61

2 5 5e-07 0.002 17.6 0.4 18 46 56 84 51 91 0.86

3 5 2e-05 0.077 12.5 2.5 26 48 94 116 88 122 0.86

4 5 2e-06 0.008 15.7 1.5 25 48 137 160 119 164 0.86

5 5 2.3e-06 0.0091 15.5 1.9 24 48 184 208 164 210 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	3	1.2e+04	-4.1	3.5	9	30	21	42	17	55	0.61
2	5	5e-07	0.002	17.6	0.4	18	46	56	84	51	91	0.86
3	5	2e-05	0.077	12.5	2.5	26	48	94	116	88	122	0.86
4	5	2e-06	0.008	15.7	1.5	25	48	137	160	119	164	0.86
5	5	2.3e-06	0.0091	15.5	1.9	24	48	184	208	164	210	0.82

Coding Sequence: ATGCGACGTCTCCTTgttgcagccctcggccacctcggcgctctgtggcaggcgcagccgccgccgccgccaccaccaccacagcagcagcagcaaccgcagccgcagttcacgtgcggcgAGTGCGGGAAGGGGTTCCAGGTCCGGGACTCGTTGTACAAGCACCGGAGCGTCCACAGAGGCGCGACCACGTGCCCGATCTGCAACGCGGTTCTGAACCGGCGCGGCTACCTGCGGCACCACATGGCCCTCCACCTGGGCGTGCACCGCGGCGCCACGCGCTGCCCCATCTGCCAGGCGGTGTTGAGCAGGCGCGCGCACCTGCACCGACACCTGGCCGCCGTGCACGGCGTGGCCCGCGGGCCGCGCGGCTCGGCCCCGGCAAGCGTGCTCGTCCACAGAGGGGCGACCCAGTGCCCCATCTGCCGGACCGTGCTGAGCCGGAAGGGCCACCTGCGCCGCCACCTGGCCATGGTGCACAGGGTGTACAAGGTGCACAAGGCCACACCggacaactcgctgtcggctcaccagagcgtgcacacgggctcctcccagtgccccgtctgccaggccgttctcagcaggcgcaggcacctcaagcggcacatgctCGTGGTGCACGGCATCGTCTTGGACCTGCAGCCCCTCTGA
Protein Sequence: MRRLLVAALGHLGALWQAQPPPPPPPPQQQQQPQPQFTCGECGKGFQVRDSLYKHRSVHRGATTCPICNAVLNRRGYLRHHMALHLGVHRGATRCPICQAVLSRRAHLHRHLAAVHGVARGPRGSAPASVLVHRGATQCPICRTVLSRKGHLRRHLAMVHRVYKVHKATPDNSLSAHQSVHTGSSQCPVCQAVLSRRRHLKRHMLVVHGIVLDLQPL

Sequence clustering based on sequence similarity using MMseqs2