Mmes016149.1
Basic Information
- Insect
- Mechanitis messenoides
- Gene Symbol
- TGIF2
- Assembly
- GCA_959347415.1
- Location
- OY365768.1:2922215-2927184[+]
Transcription Factor Domain
- TF Family
- Homeobox
- Domain
- Homeobox
- PFAM
- PF00046
- TF Group
- Helix-turn-helix
- Description
- This entry represents the homeodomain (HD), a protein domain of approximately 60 residues that usually binds DNA. It is encoded by the homeobox sequence [7, 6, 8], which was first identified in a number of Drosophila homeotic and segmentation proteins, but is now known to be well-conserved in many other animals, including vertebrates [1, 2], as well as plants [4], fungi [5] and some species of lower eukaryotes. Many members of this group are transcriptional regulators, some of which operate differential genetic programs along the anterior-posterior axis of animal bodies [3]. This domain folds into a globular structure with three α-helices connected by two short loops that harbour a hydrophobic core. The second and third form a helix-turn-helix (HTH) motif, which make intimate contacts with the DNA: while the first helix of this motif helps to stabilise the structure, the second helix binds to DNA via a number of hydrogen bonds and hydrophobic interactions, which occur between specific side chains and the exposed bases and thymine methyl groups within the major groove of the DNA. One particularity of the HTH motif in some of these proteins arises from the stereo-chemical requirement for glycine in the turn which is needed to avoid steric interference of the β-carbon with the main chain: for cro and repressor proteins the glycine appears to be mandatory, while for many of the homeotic and other DNA-binding proteins the requirement is relaxed.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5e-08 1.3e-05 25.5 0.4 1 54 92 148 92 149 0.87
Sequence Information
- Coding Sequence
- ATGTTACCACCTACGGCCGGTATAGCACAAGATCAACGTGACCGGACCGAAATGGCGTACCAGCAACGACGCGACGTGCGAGAAATAACAAGAGACATTATCAGAGAAGCCCGAGttacaaatagaaaacaatCTATGTCGCCTGGAGCGCGGGATCGCTTCCCGTCCACGTCGTCCACCGACGACAATGAGTCGGGGACGGATGGGGAGGCCGACCGGAGGCGTATCAGCCACGGAGCTCACATCGTGCAACCACCGggtGGTATAATAGTCCGCAAGCGACGTGGCAACCTTCCCAAGCATTCAGTGAAGATCCTGAAACGTTGGTTGTACGAGCACAGGTACAACGCCTACCCCAGCGATGCTGAGAAACTCACACTTAGTCAGGAGGCCAACCTCACTGTGTTACAgGTATGCAACTGGTTCATCAACGCGCGCCGCCGCATCCTGCCCGAGATGATCCGTCGCGAGGGCCACGACCCGCTGCACTACACCATCTCCCGCCGCGGCCGCAAGCAGCTGGGCGGCGCCGGCTCCAGCTcgggcgccgccgccgccgcctgGGACGGGGAGGGGGAGGCAGAGGGGGAGGGCGACGGCGACCGCGGCCGCGACCACGACTACGGCGACGGGCTGCTGGTGTACCGCAGCGACGGAGACGACATCGCGGACGCCGAGGAGGGCTACTCCTCCAGCGCCGTCAGCGAGGAGGAGGTCAAGTACGACCCCTCGGTGTGGCAGAGCGTCATACGGTACGGGCCTGAAGATAGGGACCTGCATCCCGCGGCTAGAGGGTCGGCGGCGGTGGTGACGGTGCGCACGGCGGAGGAGGGCGCGGCGGAGGAGGCGGCGGGCGAGGGCGGCGGCTGGCACCCGCAGCTGGCGCACCTGCCGCAGCTGCCGCACCCGCTGCGCCGCAAGCCCGACGAGAGGGACAAGTTCAAGTGCCTGTACCTGCTGGTGGAGACCGCCGTGGCCGTGCGCCAGCGCGAGCAGGAGCAGGAGGAGGTGCCCGTCTAG
- Protein Sequence
- MLPPTAGIAQDQRDRTEMAYQQRRDVREITRDIIREARVTNRKQSMSPGARDRFPSTSSTDDNESGTDGEADRRRISHGAHIVQPPGGIIVRKRRGNLPKHSVKILKRWLYEHRYNAYPSDAEKLTLSQEANLTVLQVCNWFINARRRILPEMIRREGHDPLHYTISRRGRKQLGGAGSSSGAAAAAWDGEGEAEGEGDGDRGRDHDYGDGLLVYRSDGDDIADAEEGYSSSAVSEEEVKYDPSVWQSVIRYGPEDRDLHPAARGSAAVVTVRTAEEGAAEEAAGEGGGWHPQLAHLPQLPHPLRRKPDERDKFKCLYLLVETAVAVRQREQEQEEVPV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00421266;
- 90% Identity
- iTF_00421266;
- 80% Identity
- iTF_00959331;