Mbor017165.1
Basic Information
- Insect
- Marronus borbonicus
- Gene Symbol
- GCFC2_1
- Assembly
- GCA_902655005.1
- Location
- LR737382.1:1351146-1352126[+]
Transcription Factor Domain
- TF Family
- GCFC
- Domain
- GCFC domain
- PFAM
- PF07842
- TF Group
- Unclassified Structure
- Description
- This entry describes a domain found in a number of GC-rich sequence DNA-binding factor proteins and homologues [4, 5], as well as in a number of other proteins including Tuftelin-interacting protein 11 [1]. While the function of the domain is unknown, some of the proteins it is found in are reported to be involved in pre-mRNA splicing [1, 2]. This domain is also found in Sip1, a septin interacting protein [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.3 1.9e+03 -1.8 0.0 181 192 19 30 7 60 0.53 2 2 2.4e-11 1.5e-07 31.4 0.1 3 63 66 125 64 139 0.90
Sequence Information
- Coding Sequence
- ATGTTGGGAAGCAATTTGTGGCGGGCACTCAAGTCTTTAGCTCCTGACGCTGTGGTAGCCAAAATTAGaCGAGCTATAGAAAGTGATGAGATATCCCAGCAAGACATCCTTCaattggaaaaggaaaaagagcAGATCGAAACTGAAATGCATACTGTATTCGGAAGCTTAATGGATGAATACTCCTCAGTCgctaatattttgattaaattcgaGCAGTGGAGGGAAACTGATATGCCGGCTTATACGGATGCGTATGCTACATTATGTTTAGTGAGGGTAATGAATGTGCTAATAcgcctaaatttaattttctgggACCCGCTTACCGATTCTGTAGATCTGGAGAAATTAGAACGGTACAGGACATTGGCTCGGACGGTTTACATGATGACGAAACGGAAACTATTTTATTCAGCCACCCTGATGTAA
- Protein Sequence
- MLGSNLWRALKSLAPDAVVAKIRRAIESDEISQQDILQLEKEKEQIETEMHTVFGSLMDEYSSVANILIKFEQWRETDMPAYTDAYATLCLVRVMNVLIRLNLIFWDPLTDSVDLEKLERYRTLARTVYMMTKRKLFYSATLM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -