Mser011798.1
Basic Information
- Insect
- Malthinus seriepunctatus
- Gene Symbol
- -
- Assembly
- GCA_963924605.1
- Location
- OZ004601.1:37419234-37420368[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.003 74 4.0 0.2 12 43 109 141 106 147 0.70 2 5 0.022 5.6e+02 1.2 0.0 22 45 149 172 143 179 0.82 3 5 0.00032 8.1 7.1 0.1 22 45 177 200 170 203 0.88 4 5 1e-05 0.26 11.9 0.1 21 52 204 235 200 235 0.88 5 5 0.00028 7.2 7.3 0.0 21 48 232 259 228 262 0.90
Sequence Information
- Coding Sequence
- ATGGAAAATGAAGACCACGAAGTAGATTTTCATTCATCATTAGAGCCCGATGTGATTATAGATGATCATTCGggAGATCGTTATTTCTCAGACAATCCTTTAGGACCAAATCATGACTATAGAAACAATATACCGGACGCTGCTGGTCCAGAAATTTCACTTATACCGGTTAGAAGAAATtcactgaaaataaaaatgtacgaCAAAATATTATGTAAAGATGGTTCGTTGGATATGCAAGTTCCAAAAGTGCAAAGAATTATTCAAAGATCTCCTCGCCAAAATGTAAGACTGATATCACACGAAGAAATGGTACAAGCAGAAACTGAATGTGTACACTCGAAACGTAAATCCTTACCTTTGGAAAAATGTCCaatttgtaaaaagttttttcgTCGCATGAAAACGCATTTACAAAAACACGAGAATGTTAATAGGGATCCTAACGATCCACTAACATGTCGATTTTGTCGAAAAAGTTTTAATACCGGAAGTAATTTAAGTATACATATGCGAACGCATACAGGTGATAAACCGTATATTTGTGAAATTTGTACAAAAGGTTTTGCACAATCTTGTAATTTAATAAACCATATGCGTATTCATACAGGTGAGAGGCCTTTTAAATGTCCTCATTGTGATCGTGCTTTTACACAATCgggtaatttaaataatcacgTTAGGTTACACACCGACGAGAAACCATTTAAATGCCATTTTTGTGACAAAGCATTTACTCAATCGGGCAATCTTAATTCTCATATAAGAAACAATCACAAAGTTATGACTAATGGCGAAAACGAACTGAATCAAGTTCagtaa
- Protein Sequence
- MENEDHEVDFHSSLEPDVIIDDHSGDRYFSDNPLGPNHDYRNNIPDAAGPEISLIPVRRNSLKIKMYDKILCKDGSLDMQVPKVQRIIQRSPRQNVRLISHEEMVQAETECVHSKRKSLPLEKCPICKKFFRRMKTHLQKHENVNRDPNDPLTCRFCRKSFNTGSNLSIHMRTHTGDKPYICEICTKGFAQSCNLINHMRIHTGERPFKCPHCDRAFTQSGNLNNHVRLHTDEKPFKCHFCDKAFTQSGNLNSHIRNNHKVMTNGENELNQVQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00950210;
- 90% Identity
- iTF_00950210;
- 80% Identity
- iTF_00951276;