Meup046341.1
Basic Information
- Insect
- Macrosiphum euphorbiae
- Gene Symbol
- ZSCAN16_7
- Assembly
- GCA_949089665.1
- Location
- CARXXK010000694.1:153535-154023[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 6.7 1.7e+04 -2.1 0.0 27 43 8 24 5 28 0.79 2 6 0.0036 9.2 8.4 0.0 20 43 29 52 23 61 0.84 3 6 0.44 1.1e+03 1.7 0.1 21 41 58 78 53 83 0.75 4 6 0.15 3.7e+02 3.2 0.1 20 40 85 105 78 110 0.72 5 6 0.051 1.3e+02 4.7 0.0 20 43 113 136 104 142 0.84 6 6 0.0075 19 7.4 0.0 16 40 137 161 134 162 0.85
Sequence Information
- Coding Sequence
- ATGGAGAAGAAATCTTACCCATGTGATGTCtgtgacaagtcgttctctgtgagtagcAATTTGATGGCACATCGACGaacgcacactggcgaaaaaccgtacgcgtgcgatgtatgcgacaagtatTTCACTCAAAGTGGCAATTTGACATTACATAGACTcacgcacactggcgaaaaaccgtacgagtgcgatatatgcgacaagtcgttctctgtgagtagcCATTTGACATCACATCGACgaacacacactggtgaaaaaccgttcgcgtgcgatatatgcgacaagtcgttctctgtgagtagcCATTTGACATCACATCGACgaacgcacactggtgaaaaaccgtacgcgtgcgatgtatgtgacaagtattTCACTCAAAATGGCGATTTGACAAAACATAGACTcacgcacactggtgaaaaaccgtacgcatgcgatatatgcgacaagtatTTCACTCAAAGTGGCAATTTGACATGA
- Protein Sequence
- MEKKSYPCDVCDKSFSVSSNLMAHRRTHTGEKPYACDVCDKYFTQSGNLTLHRLTHTGEKPYECDICDKSFSVSSHLTSHRRTHTGEKPFACDICDKSFSVSSHLTSHRRTHTGEKPYACDVCDKYFTQNGDLTKHRLTHTGEKPYACDICDKYFTQSGNLT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00942093;
- 90% Identity
- iTF_00942093;
- 80% Identity
- iTF_00942093;