Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.055 1.4e+02 4.6 0.0 21 43 30 52 21 57 0.86

2 8 0.0025 6.4 8.9 0.1 20 44 57 81 51 89 0.84

3 8 0.15 3.8e+02 3.2 0.1 20 43 85 108 80 113 0.85

4 8 0.11 2.8e+02 3.7 0.1 14 43 107 136 102 145 0.70

5 8 0.27 6.9e+02 2.4 0.1 20 43 141 164 134 167 0.79

6 8 0.12 3.1e+02 3.5 0.1 14 43 163 192 158 196 0.81

7 8 0.019 47 6.1 0.1 14 43 191 220 188 224 0.85

8 8 0.12 2.9e+02 3.6 0.0 20 43 225 248 218 254 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.055	1.4e+02	4.6	0.0	21	43	30	52	21	57	0.86
2	8	0.0025	6.4	8.9	0.1	20	44	57	81	51	89	0.84
3	8	0.15	3.8e+02	3.2	0.1	20	43	85	108	80	113	0.85
4	8	0.11	2.8e+02	3.7	0.1	14	43	107	136	102	145	0.70
5	8	0.27	6.9e+02	2.4	0.1	20	43	141	164	134	167	0.79
6	8	0.12	3.1e+02	3.5	0.1	14	43	163	192	158	196	0.81
7	8	0.019	47	6.1	0.1	14	43	191	220	188	224	0.85
8	8	0.12	2.9e+02	3.6	0.0	20	43	225	248	218	254	0.81

Coding Sequence: ATGGAGAAGAACTCTTACCCTTGCGATGTCTGTGACAATTCATTCAGCCAAAGTACCAGTTCAACGATACACAAACGCACCCATACTGGCGAAAAAtcctacgcatgcgatgtatgtgacaaatccttcagccaaagtaccaatttaacgaatcatcgacgcacacatactggcgaaaaaccgtacgcatgcgatgtatgtgacaaatccttcagccaaagtactaatttaacgaatcatcgacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaagtcttTCAGTCAAAATACCCATTTGAcaaaacatcgacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaagtcgttcgctGTAAGTTCTGATTTAACGaatcatcgacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaagtcgttcgctGTAAGTTCTGATTTAACGAAACaccgacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaagtcgttcgctGTAAGTTCTGATTTAACGAAACaccgacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaaatccttcagccaaagtaccagtttaacgaatcatcgacgcacacatactggagaaaaaccgtacgcatgcgatgtatgtgacaagacATTCTCTGTAAGTGGCAATTTGGTGGCACACAAGCGGAAGCACAAGGAACACTGA
Protein Sequence: MEKNSYPCDVCDNSFSQSTSSTIHKRTHTGEKSYACDVCDKSFSQSTNLTNHRRTHTGEKPYACDVCDKSFSQSTNLTNHRRTHTGEKPYACDVCDKSFSQNTHLTKHRRTHTGEKPYACDVCDKSFAVSSDLTNHRRTHTGEKPYACDVCDKSFAVSSDLTKHRRTHTGEKPYACDVCDKSFAVSSDLTKHRRTHTGEKPYACDVCDKSFSQSTSLTNHRRTHTGEKPYACDVCDKTFSVSGNLVAHKRKHKEH

Sequence clustering based on sequence similarity using MMseqs2