Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 7.2 1.8e+04 -2.2 0.0 27 43 8 24 5 28 0.83

2 7 0.015 37 6.5 0.0 20 43 29 52 22 57 0.86

3 7 0.0056 14 7.8 0.0 19 43 56 80 51 85 0.85

4 7 0.032 81 5.4 0.1 19 43 84 108 79 113 0.83

5 7 0.026 65 5.7 0.1 20 44 113 137 108 146 0.83

6 7 2.1 5.4e+03 -0.5 0.1 21 33 142 154 137 167 0.71

7 7 0.22 5.7e+02 2.7 0.0 21 44 170 193 160 203 0.80

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	7.2	1.8e+04	-2.2	0.0	27	43	8	24	5	28	0.83
2	7	0.015	37	6.5	0.0	20	43	29	52	22	57	0.86
3	7	0.0056	14	7.8	0.0	19	43	56	80	51	85	0.85
4	7	0.032	81	5.4	0.1	19	43	84	108	79	113	0.83
5	7	0.026	65	5.7	0.1	20	44	113	137	108	146	0.83
6	7	2.1	5.4e+03	-0.5	0.1	21	33	142	154	137	167	0.71
7	7	0.22	5.7e+02	2.7	0.0	21	44	170	193	160	203	0.80

Coding Sequence: ATGGAGAAGAAATCTTACCCATGTGATGTCTGTGACAAGTCGTTCGGTAAAAGTTGCAATTTGATGGCACATCGACgaacgcacactggtgaaaaaccgtacgcgtgtgatgtatgtgacaagtattTCACTCAAAGTGGCGATTTGACAAAACATAGACTcacgcacactggcgaaaaaccgtacgcatgcgatatatgcgacaagtttTTCACTCAAAGTGGCCATTTGACAAAACATAGACTcacgcacactggcgaaaaaccgtacgcgtgcgatatatgcgacaagtcgttctctgtgagtagcAATTTGATGGCACATCGACgaacgcacactggtgaaaaaccgtacgcatgcgatatatgcgacaagtcgttctctgtgagtagcAATTTGATGGCACATCGACgaacgcacactggtgaaaaaccgtacgagtgcgatgtatgtgacaaagcGTTTTCTGTAAATAGCAGTTTAAAGGCACATCGACGtacgcacactggtgaaaaactgtaCGCATGCGATATATGTGACAAGTATTTCACTCAAAGTGGCGATTTGACATCACATAGACGcacgcacactggtgaaaaaccgtacgcgtgcgatTCGTTCTGTGTGAGTAACAATTTGACGGTTCACAAGAGGACACACACGAAACACTGA
Protein Sequence: MEKKSYPCDVCDKSFGKSCNLMAHRRTHTGEKPYACDVCDKYFTQSGDLTKHRLTHTGEKPYACDICDKFFTQSGHLTKHRLTHTGEKPYACDICDKSFSVSSNLMAHRRTHTGEKPYACDICDKSFSVSSNLMAHRRTHTGEKPYECDVCDKAFSVNSSLKAHRRTHTGEKLYACDICDKYFTQSGDLTSHRRTHTGEKPYACDSFCVSNNLTVHKRTHTKH

Sequence clustering based on sequence similarity using MMseqs2