Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 6 1.5e+04 -1.9 0.0 27 44 8 25 6 34 0.80

2 10 0.021 53 6.0 0.0 20 43 29 52 21 61 0.82

3 10 0.2 5.1e+02 2.8 0.1 20 43 57 80 50 85 0.82

4 10 0.017 43 6.3 0.0 16 43 81 108 76 117 0.82

5 10 0.22 5.5e+02 2.7 0.1 20 43 113 136 107 141 0.83

6 10 0.028 72 5.5 0.0 16 44 137 165 134 173 0.81

7 10 0.13 3.3e+02 3.4 0.0 22 43 171 192 165 201 0.83

8 10 0.32 8e+02 2.2 0.0 20 43 197 220 191 225 0.82

9 10 0.025 63 5.7 0.0 16 44 221 249 216 257 0.82

10 10 0.039 98 5.1 0.1 22 53 255 286 248 287 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	6	1.5e+04	-1.9	0.0	27	44	8	25	6	34	0.80
2	10	0.021	53	6.0	0.0	20	43	29	52	21	61	0.82
3	10	0.2	5.1e+02	2.8	0.1	20	43	57	80	50	85	0.82
4	10	0.017	43	6.3	0.0	16	43	81	108	76	117	0.82
5	10	0.22	5.5e+02	2.7	0.1	20	43	113	136	107	141	0.83
6	10	0.028	72	5.5	0.0	16	44	137	165	134	173	0.81
7	10	0.13	3.3e+02	3.4	0.0	22	43	171	192	165	201	0.83
8	10	0.32	8e+02	2.2	0.0	20	43	197	220	191	225	0.82
9	10	0.025	63	5.7	0.0	16	44	221	249	216	257	0.82
10	10	0.039	98	5.1	0.1	22	53	255	286	248	287	0.84

Coding Sequence: ATGGAGAAGAAATCTTACCCATGTGATGTCTGTGACAAGTCGTTCGGTAAAAGTTGCAATTTGACGACACATCGACgaacgcacactggtgaaaaaccgtacgcgtgcGATATATGTGACAAGTATTTCACTCAAAGTGGCCATTTGACATCACATAGACgaacgcacactggtgaaaaaccgtacgcatgcgatgtatgcaacaagtcgttctctgtgagtagcGATTTGACAAAACATAGACTCACGCacactggagaaaaaccgtacgcgtgcGATATATGTGACAAGTATTTCACTCAAAGTGGCCATTTGACATCACATAGACgaacgcacactggtgaaaaaccgtacgcatgcgatgtatgcaacaagtcgttctctgtgagtagcGATTTGACAAAACATAGACTCACGCacactggagaaaaaccgtacgcgtgcgatatatgcgacaagtcgttctctgtgagtagcAATTTAATGGCACATCGACGAACGCACACTGGTAAAAAACCGTACGCGTGCGATATATGTGACAAGTATTTCACTCAAAGTGGCCATTTGACATCACATAGACgaacgcacactggtgaaaaaccgtacgcatgcgatgtatgtgacaagtcgttctctgtgagtagcGATTTGACAAAACATAGACTCACGCacactggagaaaaaccgtacgcgtgcgatatatgcgacaagtcgttctctgtgagtagcAATTTAATGGCACATCGACGAACGCACACTGGTAAAAAACCGTACGCGTGCGATATATGTGACAAGTATTTCACTCAAAGTGGCCATTTGACATCACATAGACgaacgcacactggtgaaaaaccTGGCTTTTTGACGGTTCACAAGAGGACACACCCGAAACACTGA
Protein Sequence: MEKKSYPCDVCDKSFGKSCNLTTHRRTHTGEKPYACDICDKYFTQSGHLTSHRRTHTGEKPYACDVCNKSFSVSSDLTKHRLTHTGEKPYACDICDKYFTQSGHLTSHRRTHTGEKPYACDVCNKSFSVSSDLTKHRLTHTGEKPYACDICDKSFSVSSNLMAHRRTHTGKKPYACDICDKYFTQSGHLTSHRRTHTGEKPYACDVCDKSFSVSSDLTKHRLTHTGEKPYACDICDKSFSVSSNLMAHRRTHTGKKPYACDICDKYFTQSGHLTSHRRTHTGEKPGFLTVHKRTHPKH

Sequence clustering based on sequence similarity using MMseqs2